Tag: "lost" at medical news

Study shows caregiver and patient costs rise as symptom severity increases in Alzheimer's disease

...the study) are from caregiver costs, including the lost productivity of missed days of work and hours per week spent caring for loved ones. Researchers sent a survey to 1,700 non-institutionalized patients and their caregivers in households throughout the country. Patients represented all stages of the d...

Canada lags in use of blood conservation techniques

...blood-conservation techniques (reinfusion of blood lost during surgery) were used in only 2.4% of all cases. The authors report that while blood-conservation techniques are being used more frequently than when they conducted a similar study in 1995/96 and found only 8% of 2233 patients had participated in...

CRP provides another reason to lose weight and gain heart health

...upervised the weight-loss program. The weight was lost over an average of 13.9 months, including the stab...total body fatness, says Tchernof. The women also lost approximately 3 kg in muscle mass. However, the loss of muscle mass was not related to the change i...

New book aims to keep elderly drivers on the road

...s long as possible, or even regain it if they have lost the right to drive on the basis of an eye test at their local Department of Motor Vehicles," Dr. Peli says. The book combines useful information on Department of Motor Vehicle vision regulations in every state (the regulations vary widely), as well a...

Restrained and unrestrained eating behaviors affect risk for adult-onset obesity

...lthood, 87% of the women had gained weight, 8% had lost weight, and 5% had maintained a constant weight over time. Three components of eating behavior were assessed separately: restraint, or the tendency to consciously restrict food intake; disinhibition, or the tendency to overeat in the presence of pal...

Study shows weight loss with an antidepressant medicine in combination with lifestyle intervention

...ls completing the study and receiving Bupropion SR lost statistically significantly more weight than those...). Individuals assigned to Bupropion SR 400mg/day lost a larger percentage of initial body weight (10.1%) than those receiving Bupropion SR 300mg/day (7.2%...

Dental research paper

...anation for their agony. It may be that they have lost too much bone for conventional dentures to fit properly. If so, they may be candidates for a new type of denture that is held in place by dental implants. It's also possible that these patients are suffering from untreated depression. Another stud...

American Thoracic Society Journal news tips for March (first issue)

...roximately 366,600 persons in 1994, and that total lost productivity due to the disease cost $9.9 billion in that year. The study was published in the first issue for March of the American Thoracic Societys peer-reviewed American Journal of Respiratory and Critical Care Medicine. Sleep-disordered breat...

More Americans facing blindness than ever before

...mely diagnosis and treatment. However, any vision lost to glaucoma cannot be restored....

Teaching computers to replace lost sounds

...ns, improve hearing aids, and possibly find musics lost chords. Savic, a professor of electrical, computer, and systems engineering at Rensselaer Polytechnic Institute in Troy, N.Y., is accomplishing the task by reversing previous work. He previously taught computers to identify languages by distinguishin...

From sci-fi to reality microendoscopy to diagnose breast cancer?

...ves with branches leading off. Abnormal areas have lost their shine and have changed to a reddish-pink colour. Surgeons can then plot where the problem areas are before performing a biopsy or carrying out treatment. "At this stage we are not able to see the whole of the duct in many cases or all of the 1...

New findings about brain's 'compass' offer clues about Alzheimer's

...ping to explain why people with the disease become lost so easily. The findings by neuroscientists at the ...ion. She did this day after day. This patient had lost her ability for dead reckoning, or what scientists call path integration the ability to figure out ...

Analyses of Violence Against Women Act suggest legislation saved US $14.8 billion

...al health care, police responses, victim services, lost productivity, death and reduced quality of life. Researchers at the University of North Carolina at Chapel Hill School of Public Health conducted the study. A report on the work appears in the April issue of the journal Violence Against Women. Au...

Parents recognise benefits of postmortems

Parents who have lost a baby view the postmortem examination as a useful and necessary tool in helping to discover the reasons why their baby died, finds a study in this weeks BMJ. Researchers at Newcastle University surveyed 258 women who had attended a bereavement couns...

New minimally invasive surgical procedure for arthritis may delay knee replacement surgery

... the UniSpacer as a remedy 15 years ago, because I lost 15 years of my life. The procedure requires only minimal surgical intervention and is performed under general or regional anesthesia and generally takes about one hour. Most patients are able to return to normal activities within a few months. As a...

Polyphenols in tea may reduce risk of stomach, esophagus cancers

...ly produces oxidants, rogue molecules that, having lost an electron, are extremely unstable and chemically reactive. To become stable, oxidants steal electrons from other molecules in the cell. In the process, they damage critical cell proteins and genetic material. To protect itself, the body makes and u...

What is and what is not a disease?

... but surely everything is to be gained and nothing lost by raising consciousness about the slipperiness of the concept of disease....

Mice lacking fat-making enzyme are leaner, more sensitive to leptin and insulin

...g increased sensitivity to insulin. Moreover, they lost more weight than normal mice in response to leptin injections, indicating increased sensitivity to leptin. However, the researchers were surprised to find that DGAT1-deficient mice didnt eat less in response to being more sensitive to leptin. In fact...

UNC's Intrah providing emergency assistance in West Bank, Gaza

...cated in Ramallah, West Bank, where hospitals have lost water and electricity several times in the last mo... with labor complications are among those who have lost their lives as a result of road closures or hours-long delays for ambulances at checkpoints. Intrah...

Study finds widespread sympathetic nerve damage in Parkinson's disease

...out 75 percent of the patients without OH also had lost sympathetic nerve endings in one or more areas of the heart, and six of the patients without OH had an abnormal Valsalva response. The abnormal blood pressure response to the Valsalva maneuver and loss of fluorodopamine-derived radioactivity in the ...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument