Tag: "lowered" at medical news

Landmark study demonstrates potential for nerve regeneration treatment of stroke

... this animal study: When held by the torso and lowered toward a table, rats treated with Inosine after a stroke showed greater ability to place their paws on the table than untreated rats. After 19 days, treated rats had nearly normal paw-placing ability, whereas untreated rats remained 50% below normal...

Air pollutants in low-income housing, child-care centers

...aquatra says. "Lead poisoning in children leads to lowered intelligence and behavioral problems. Mold is a trigger for allergies and asthma, both of which lead to school and work absences, productivity losses and increased health costs," Laquatra says. Exposures to asbestos, carbon monoxide and radon can lea...

Exercise lowers levels of blood estrogens

...o did not lose weight, however, did not experience lowered estrogen levels. Therefore, it appears that exercise that results in weight loss is important. Two thirds of the exercisers lost some amount of body fat, and 31 percent lost more than 2 percent body fat. Among controls, in contrast, only 13 percent ...

Drug developed at Duke appears effective in treating respiratory failure in newborns

...mage," Stamler said. "In animals, ENO successfully lowered pulmonary pressures, improved oxygenation, and just as importantly, prevented the cardiovascular and respiratory deterioration commonly seen after the discontinuation of inhaled NO therapy. It also seemed to preserve heart function better than NO." B...

Lingering cognitive impairment may be linked to coronary bypass surgery

...nflammation, lack of oxygen, elevated blood sugar, lowered body temperature, showers of microscopic blood clots, and the presence of a lot of amnesia-causing drugs. The Neuropsychology article is both a reminder of the brain's vulnerability during surgery, and an open discussion of how scientists look for r...

American Heart Association updates heart attack, stroke prevention guidelines

...etes An overall healthy eating pattern Cholesterol lowered to appropriate level based on individual risk At least 30 minutes of moderate-intensity physical activity on most (preferably all) days of the week Achieve and maintain desirable weight (body mass index 18.5-24.9 kg/m2); and Normal fasting blood gluc...

'Drink at least 8 glasses of water a day' -- Really?

... evidence that the risk of certain diseases can be lowered by high water intake, the quantities needed for this beneficial effect may be less than 8 x 8, and the recommendation can be limited to those particularly susceptible to the diseases in question....

Almonds have cholesterol benefits

DALLAS, Aug. 20 Almonds significantly lowered bad cholesterol levels in a study of people with high cholesterol reported in today's rapid access issue of Circulation: Journal of the American Heart Association. Canadian researchers conducted the study, funded by The Almond Board of California an...

Eating soy during adolescence may reduce breast cancer

...er issue of Carcinogenesis. Risk also was somewhat lowered for women who ate soy regularly during the teen years but consumed little during adulthood. However, preliminary data suggest little added benefit for women who ate little soy during adolescence but a high amount of soy during adulthood. "There has b...

Chlorine dioxide gas kills dangerous biological contaminants

... a concentration of 4 mg per liter for 30 minutes, lowered the Listeria organisms a minimum of more than 1,000-fold for all three areas of apple tested. On the pulp, the average was more than a 100,000-fold reduction. These results support previous test results when Purdue scientists used the gas to sanitize...

Hospital costs much higher for motorcycle crash victims who dont wear helmets

...or before they reached the hospital, and therefore lowered the overall average cost of care. In 2000, 2,862 motorcyclists died and approximately 58,000 were injured in highway crashes in the United States, according to the National Highway Traffic Safety Administration. Unhelmeted riders are 40 percent more...

Almonds: Cholesterol lowering, heart-healthy snack

...bout one ounce (or a handful) of almonds each day lowered their LDL cholesterol by 4.4 percent from baseline. The study showed an even greater decrease of 9.4 percent in LDL cholesterol in those who ate about two handfuls of almonds a day, indicating that almonds' effect increases with increased consumpt...

Immediate treatment helps delay progression of glaucoma

...oma damage. In the treated group, eye pressure was lowered by an average of 25 percent. The study was a collaborative effort involving the University of Lund, Sweden, with centers in Malm, Helsingborg, and Lund, Sweden, as well as Stony Brook University, Stony Brook, New York. These results should be put in...

New recommendations to prevent high blood pressure issued

... increased the amount of regular physical activity lowered their systolic blood pressure by more than 4 mmHg....ts with normal blood pressure levels significantly lowered their systolic blood pressure by losing weight (fewer than 8 lbs); in addition, the percentage of pa...

Prostate cancer program at UCLAs Jonsson Cancer Center designated a site of research excellence

... to think that the risk for prostate cancer can be lowered through diet, said Glaspy, who also has studied a low-fat diet with fish-oil supplements in women with breast cancer. Men in Japan, where they eat more omega-3 fatty acids, have a much lower incidence of prostate cancer than men in American, where we...

New study shows weight loss decreases ACE enzyme that controls blood pressure

...and hormones that are produced in fatty tissue are lowered by modest dietary weight loss." After first conducting studies in rodents, which demonstrated that all the components of the renin-angiotensin system were produced in fat tissue, Harp and colleagues extended their work to humans, she said. Volunteers...

Perception of punishment undermines HIV treatment adherence

...hment was one of several variables associated with lowered self-esteem and increased depression. "The findings from the present study highlight the need for research addressing the effects of treatment for psychosocial issues such as depression, coping, and punishment beliefs about HIV on self care and, in ...

New drug linked to fewer deaths among kidney patients undergoing hemodialysis

...s. The National Kidney Foundation has subsequently lowered its recommended phosphorus blood levels. Today, many kidney failure patients undergoing hemodialysis take medications that bind dietary phosphorus, thereby allowing its excretion in the stool rather than its absorption by the body. Originally, alum...

The eyes have it: Study shows infants more tuned into wider world than previously believed

...here the experimenter looked at the child and then lowered the cloth over her eyes turning toward one of the ...sed to a headband condition where the experimenter lowered the cloth to just above her eyebrows. Once again more infants looked at the correct toy when the ex...

Scientific task force to examine usefulness of testosterone replacement therapy in older men

... instance, may be tempted to blame this problem on lowered testosterone. However, in the vast majority of cases, erectile difficulties are due to circulatory problems, not low testosterone. Still, a small percentage of men may be helped by prescription testosterone supplements. These supplements often are...

1 2 3 4 5 6 7 8

(Date:11/24/2014)... (PRWEB) November 24, 2014 Global ... 6.19 billion by 2020, according to a new ... rates of cardiac arrhythmias clubbed with growing global ... this market. Though still in the budding stage, ... rise in usage rates in the recent times, ...
(Date:11/24/2014)... 2014 Residents of retirement communities in ... year’s SENIORS GOT TALENT, an annual online talent competition ... players to classic crooners, to seniors partying on a ... are indeed living young. , “SENIORS GOT TALENT, while ... cash prize, has always been about highlighting the vibrancy ...
(Date:11/24/2014)... York (PRWEB) November 24, 2014 The ... by the Family and Children's Association to ... as soap, shampoo, mouthwash and other such items.The Association's ... who are home bound, living in nursing homes, assisted ... to greatly enhance the well being of seniors throughout ...
(Date:11/24/2014)... SafeHandles™ announced that they will be featured ... Jr, airing via Discovery Channel. Dates and show times ... non-invasive, replaceable, and affordable germ protective device. This segment ... and adhesives to promote hand hygiene in high traffic ... SafeHandles is the desire to make a positive impact ...
(Date:11/24/2014)... Pittsburgh, PA (PRWEB) November 24, 2014 ... as he was trying to cross the street in ... "The driver never saw him. I came up with ... easily visible at night." , He developed the Safety ... night or in low-lighting conditions. The device ensures that ...
Breaking Medicine News(10 mins):Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 2Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 3Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 4Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 2Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 3Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 2Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 3Health News:New Episode of Innovations TV Series to Feature SafeHandles™ 2
Other Tags
interactivemucolipidosisregularlyace2elbowtenniscushingpituitaryusgsagigrapefruitreleasewishespacemakerafghanistanreturning