Tag: "marrow" at medical news

AIDS Treatments Seek To Eradicate Virus, Restore Immunity

...efundamental questions about the viability of bone marrow transplantationin AIDS therapy. The team plans to treat about a dozen HIV-infected patients with lymphoma-- patients for whom traditional chemotherapy has failed, and no other treatmentis possible. These patients will receive the same blitz...

Duke Researchers Identify New Pulmonary Syndrome Associated With Bone Marrow Transplantation For Breast Cancer

...id killing immunecells, physicians remove the bone marrow that produces them before beginningtreatment. ... the course of chemotherapy is completed, the bone marrow cells arere-infused into the patient (autologous transplant), where they grow and createa new immune...

BioNumerik Reports Preclinical Antitumor Data On Two Novel Supercomputer Engineered Anticancer Agents At 89th Annual AACR Conference

...ney toxicity (cisplatin), nausea andvomiting, bone marrow suppression, neurotoxicity and other toxicities. BioNumerik has designed BNP7787 to enhance selective inactivation of toxicplatinum drug species and to produce a less toxic drug relative to otherprotecting agents. BioNumerik presented preclinical an...

Anti-Clotting Drug May Cause Potentially Fatal Platelet Disorder

...percent ofpatients developed life-threatening bone marrow failure within the first threemonths of beginning therapy. Consequently, it has been recommended that bloodtests be performed every two weeks for three months after starting onticlopidine to identify this side effect early, before lethal complication...

Researchers Identify Candidate Immunosuppressant With Fewer Side Effects

...6, prevent the rejection of foreign organs or bone marrow by disrupting thesignaling pathway that activates T cells. But both drugs can cause kidney andnervous system damage, making them unsuitable for wider clinical application.The newly identified peptide prevents a single, specific step in the immunesyst...

New Study Designed To Improve Outcomes In Women With Metastatic Breast Cancer

...f all blood cells. Stem cellswill regenerate bone marrow function in the patient after high-dosechemotherap...r Breast cancer must not involve the brain or bone marrow Must have responded to conventional chemotherapy given after diagnosis ofmetastases Are otherwise fi...

OHSU Scientists Begin Human Trials Of A Drug Aimed At The Underlying Cause Of Chronic Myelogenous Leukemia

... rapidly dividing cells or they have undergonebone marrow transplantation aimed at replacing their diseased marrow. "This experimental therapy is different than chemotherapy because ittargets leukemia cells and leaves normal cells alone," explained Druker. "When I was diagnosed with leukemi...

BioNumerik Reports The Supercomputer Supported Discovery Of New, Non-Toxic Chemotherapy Protecting Agent

...isplatin-induced kidney toxicity,vomiting and bone marrow toxicities while increasing cisplatin's antitumoractivity. In these studies, tumor bearing animals receiving BNP7787 andcisplatin experienced an increase in complete tumor remissions and reducedtoxicity compared to animals receiving the same dose of...

Cure Rate Soars For Some AML Patients Receiving High-Dose Drug

...e., malignant cells are not visible when a bone marrow sample is examined by microscope). Post-re...y used forms of post-remission therapy are bone marrow transplantation and intensification therapy using high-dose cytarabine. This study, the firs...

Promising New Drug Uses Antibody Targeted Chemotherapy To Fight Leukemia

...cerous and rapidly replace and destroy normal bone marrow and blood cells. AML is among the most serious for...completeremission, and some also must undergo bone marrow transplants. Up to half ofpatients with AML, even after such intensive treatment, have residual leu...

Clinical Trial Demonstrates Experimental Growth Factor Increases Eligibility For Autologous Stem Cell Transplantation

... stimulating stemcells --the body's primitive bone marrow cells and the ultimate source of allblood cells-- to migrate out of the bone marrow and into the bloodstream. There,they can be collected and stored for safekeeping while patients und...

USC Researcher Lights Up The Immune System To Help Heart Transplant Recipients

...atment of potentially lethal complications of bone marrow transplantation, such as graft vs. host disease, as well as in other solid organ transplants, including lung, small bowel and kidney." Barr said that outside of the present study, he and other investigators have successfully used photopheres...

Hopkins Researchers Develop New Therapy For Autoimmune Disorders Such As Rheumatoid Arthritis And Lupus

...es using high-dose cyclophosphamidefollowedby bone marrow or stem cell transplantation to repopulate the imm...that transplants are unnecessary. "Stem cells,the marrow cells that reconstitute the immune system, are resistant to the drugand will repopulate in the marro...

Fred Hutchinson Cancer Research Center And Targeted Genetics Corp. Publish Data On Adoptive Immunotherapy For HIV

...zedinternationally for its pioneering work in bone marrow transplantation, theCenter has four scientific divisions collaborating to form a unique environmentfor conducting basic and applied science. One of 35 National CancerInstitute-designated comprehensive cancer centers in the country, it is the onlyone...

Campaign Targets Oral Complications Of Cancer Treatment

...ck radiation, chemotherapy for anycancer, and bone marrow transplantation can cause oral complications that mayfurther compromise patients' health and quality of life, as well as affect theirability to complete cancer treatment. Many oncologists, dentists and patients,however, are unaware of the right step...

Campaign Targets Oral Complications Of Cancer Treatment

...eck, chemotherapy for any type of cancer, and bone marrow transplantation. Among the most common complications are painful,inflamed gums; mouth ulcers; bleeding; infection; and salivary gland dysfunction that leads to dry mouth and rampant tooth decay. Oral side effects may be acute, or they may last a li...

Promising Bone Cancer Therapy Advances To Next Level

...hat thetin-117m targets only the bone, sparing the marrow and soft tissue, but stilldelivers a highly locali...ients must have no substantialdamage to their bone marrow as a result of their cancer, as well as no bonefractures. They cannot have had radiation therapy fo...

Duke Doctors Can Now Cure Most Babies Born With Fatal Immune Disease

...une disorder by giving them a family member's bone marrow withinthe first 3 1/2 months of life. All ...allergy and immunology. Giving them a bone marrow transplant soon after birth allows them tobuild a healthy immune system before opportunistic infecti...

Interleukin-2 Boosts Cancer Vaccine Effectiveness In Mice

...onse in people with HIV or patients undergoingbone marrow transplantation." Significant results from the U-M study include: Mice injected with three times the lethal dose of tumor (sarcoma) cells andthen vaccinated with a sarcoma-specific dendritic cell vaccine showedsubstantial reduction in tumor size, wh...

Bone Marrow With Organ Transplants Reduces Rejection Of Transplanted Organs, Reports University Of Pittsburgh

...sssevere in patients who receive infusions of bone marrow from the same donor,researchers from the Universit...adly. "While the ultimate goal in some of the bone marrow patients is to take them offimmunosuppressive drugs, we do not want to interfere with the naturalpea...

1 2 3 4 5 6 7 8 9 10

(Date:8/21/2014)... (PRWEB) August 21, 2014 Recently, ... among their patients. Alternative medicine is on the ... to millenials. According to The Fiscal Times, young ... treatments over conventional medicine. , The Fiscal Times ... many millenials are embracing alternative medicine. The article ...
(Date:8/21/2014)... with advanced laryngeal cancer appear to have better ... nonsurgical chemoradiation. , Author: Uchechukwu C. Megwalu, M.D., ... Mount Sinai, New York, and colleagues. , Background: ... are diagnosed each year and squamous cell carcinoma ... Prior to 1991, total surgical removal of the ...
(Date:8/21/2014)... NC -- Researchers have pinpointed the environmental source of ... Southern California for decades. It literally grows on trees. ... of a 13-year-old girl, who spent the summer gathering ... hardest hit by infections of the fungus named ... Cryptococcus , which encompasses a number of species including ...
(Date:8/21/2014)... (HealthDay News) -- Not only is eating better and exercising ... of health-care dollars a year, a new study finds. ... health sciences at Wake Forest Baptist Medical Center in Winston-Salem, ... 2 diabetes patients. Participants ranged in age ... an intensive "lifestyle change program" focused on diet and exercise, ...
(Date:8/21/2014)... The W. Montague Cobb/ NMA ... national voice in the elimination of health disparities, ... the 112th National Medical Association’s (NMA) Annual Convention ... John Ruffin, Ph.D, former Director of the National ... life-long career and innovations have had a significant ...
Breaking Medicine News(10 mins):Health News:Van Uden Center Sees Growth in Alternative Medicine 2Health News:Surgery associated with better survival for patients with advanced laryngeal cancer 2Health News:Fungus deadly to AIDS patients found to grow on trees 2Health News:Getting Healthier a Big Money-Saver for People With Diabetes 2Health News:W. Montague Cobb/NMA Health Institute Honors Three Outstanding Leaders in Health Disparities 2
Other Tags
titantedstinkyhypertensivesdiesellaybeachremovesaceseekpreliminarymitralagesfactquotationsretarded