Tag: "meat" at medical news

Cattle: Latest Weapon In The War On Cancer?

...le new product to Australia's$4 billion cattle and meat industry. "Overseas scientists have demonstrated ... GAGs æ so the value-addingpotential for the meat industry is considerable," Dr Harper says. "The real challenge is to identify which of the GAGs are...

Polish Dumpling-Like Particle Has Potential In Drug Delivery

...after a popular Polish dumpling filled either with meat or sweets. While the Polish knedel is a sumptuous taste treat, the Washington University knedl is a synthetic nano-sized particle that its creators hope someday will be the carrier of drugs or genes for biomedical applications and therapies. Karen...

Cherry Hamburgers Lower In Suspected Carcinogens

... unusualcombination. Adding cherries to hamburger meat retards spoilage and reduces the formation ofsuspe...ation alsocauses discoloring and texture change of meat during storage. In the study, MSU researchers found that ground beef patties containing15 pe...

Soy foods reduce risk of coronary heart disease

...etable protein from soy, other legumesand cereals, meat substitutes and vegetarian cold cuts. Compared to the low-fat control diet, the test diet significantly lowered totalcholesterol levels, LDL cholesterol and the ratios of good to bad cholesterollevels. "Dietary strategy needs to be broadened to inclu...

Moooooove over, chicken! Study shows lean red meat can play a role in low-fat diet

For years, physicians have avoided red meat when designing heart-healthy dietsfor their patien...e randomly assigned to consume 80 percent of their meat intake fromlean red meats (beef, veal or pork) for five to seven days a week for ninemonths, or to e...

National Cancer Institute to support statewide UNC-CH colon cancer study

.... Diets high in fat and thosethat include a lot of meat -- especially grilled meats - appear to boost therisk of colon cancer, research indicates. Many volunteers for Sandler's study already have shown interestparticipating in the new work as well, Campbell said. They will be randomlyassigned to f...

New sterol spread can reduce bad cholesterol

...ters are similar to cholesterol, which is found in meat and dairy products. But sterols are derived from plant oils. The substances are structurally similar to cholesterol so they interfere with cholesterol absorption in the intestines. The good news is that the sterol spread seems to lower LDL -- low-d...

Traditional Chinese diet helps ward off heart disease

.... In Pan Yu, villagers consumed about 13 grams of meat protein daily per 1,000 calories, along with about...co, westernized Chinese consumed about 24 grams of meat protein, 51 grams of dairy products, 117 grams of vegetables and 37 milliliters, or less than a quar...

Undercooked meat is chief cause of parasite infection in pregnancy

Eating undercooked, raw or cured meat during pregnancy is the main risk factor for the c...uthors found that eating raw, undercooked or cured meat contributed to between 30 percent and 63 percent of infections. Contact with soil contributed to up...

Pacific Northwest National Laboratory wins three R&D 100 awards

...nt approval of irradiation to kill bacteria in red meat expands the need for an accurate, inexpensive way to measure how much radiation food and other products are getting. Licensed to Sunna Systems Inc., of Richland, Wash., this dosimeter technology offers instantaneous readings that can be repeated. T...

Environment contributes to drug tolerance

...spects," he says. Much like a butcher working in a meat freezer who isn't affected by the cold while at work but can feel cold at home, Cepeda-Benito says, the body, over time, begins to prepare itself, through learning, for the environment it is used to consuming the drugs in, resulting in a lessening of...

New Mayo Clinic Healthy Weight Pyramid helps you lose weight and keep it off!

...quals 70 calories. That is 1/3 cup beans, 3 ounces meat or fish or 1 cup skim milk. Fats, the fourth level of the pyramid, includes heart-healthy olive oil, nuts, canola oil and avocados (3-5 servings/day). One serving of fat equals 45 calories. That is 1teaspoon oil or 1 tablespoon nuts. Sweets form the ...

Imperial statistician estimates size of French BSE epidemic

...ed animals are likely to have been slaughtered for meat this year in France, where no age restriction for ...t tissue from the central nervous system in French meat and bonemeal was banned in mid-1996, it is too soon to judge the effectiveness of this ban. Dr Donn...

Toward a better burger: "Where's the selenium?"

...rofitability to producers," Finley said. While red meat has been widely implicated as a risk factor for certain cancers, including cancer of the prostate and others, researchers believe these risks could be ameliorated somewhat by the substitution of high selenium beef for low selenium beef, Finley sugges...

Science, engineering and technology news tips -- August 2001

... of human disease in England were likely caused by meat contaminated with BSE prions. But in some cases, the prions are incompatible. For example, mouse prions can attack hamsters, but hamster prions do not thrive in mice. The UC Davis team used their model to see what would happen if incompatible, forei...

Team studies use of Sandia technology to ensure 'farm-to-fork' safety of the nation's food supply

... cream may also have the potential for sanitizing meat cutters equipment and sanitizing cattle trucks and poultry houses. One Kansas State food scientist doing research with the foam found a complete kill of unattached cells of common food-born pathogens. The real test will come when the foam is used on ...

Childhood eating habits may persist into adolescence and lead to obesity

...ilies were more likely to maintain a high fat/high meat diet suggesting that economic development in China has made expensive foods such as meat and cooking oils more affordable. This also may suggest that with the rise in living standards, thos...

Primate bushmeat : Populations exposed to simian immunodeficiency viruses

...n the rainforests, and subsequently sold for their meat on markets in Yaound, surrounding villages and logging concessions, or kept as pets were tested for hiv cross-reactive antibodies. Strong serological reaction, indicating infection by an SIV, was found in 16.6% of the monkeys sampled. Out of 16 speci...

Fatty acid from fish oil fights arrhythmias, sudden death

...tein without the high saturated fat found in fatty meat products....

Soy protein in the diet produces health benefits, regardless of isoflavone content

...itute. Low-fat soymilk and a variety of soy-based meat substitutes such as soy hot dogs and tofu burgers took the place of the usual protein sources in the two soy protein-containing diets. Body weight, blood lipids, and blood pressure were measured before and after each diet. After each soy diet, total...

1 2 3

(Date:6/19/2013)... 19, 2013 Elsevier, a world-leading provider of ... announced today the publication of the National Osteoporosis ... management of osteoporosis in postmenopausal women and older ... Published in 2009 in Maturitas , the ... update is timely with an additional focus on ...
(Date:6/19/2013)... June 19, 2013 Ultimate Medical Academy ... an 11.5-hour broadcast on WFLA News Channel 8. Since ... more than $84 million for All Children's Hospital in ... themed "30 Years of Miracles," marked the second year ... UMA employees worked the phones during the Telethon, which ...
(Date:6/19/2013)... Next Thursday, June 27, 2013, ... organization, and Muzzy Lane Software , a ... the Games for Health community to their interactive ... toward students in grades 4-7 and designed to ... positive choices. The game is part of a ...
(Date:6/19/2013)... Recently, SoCal CEO Magazine staff was on hand ... in a series of six workshops where people with and without ... the mosaic tiles in their permanent location under the direction of ... Maxwell. , This mural project began in March of 2013 ... three years ago with the goal of promoting ...
(Date:6/19/2013)... (PRWEB) June 19, 2013 Maui'd ... is dedicated to being an effective and cost effective ... needs. They have partnered up with Tom Barefoot’s Tours ... discounts on most of Hawaii’s activities. , They have ... clients can get the lowest prices on their Hawaii ...
Breaking Medicine News(10 mins):Health News:Ultimate Medical Academy Rallies in Support of All Children's Hospital 2Health News:Ultimate Medical Academy Rallies in Support of All Children's Hospital 3Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 2Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 3Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 4Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 5Health News:Arc Creates Huge Mosaic Mural to Highlight the Need for Greater Respect of People with Disabilities 2Health News:Maui'd Forever Pleased to Offer Price Guarantee on Hawaii Activities 2
Other Tags
capillarymaterialisemisshapentacticsoupamchitkapassivelawnsstaraffirmsmelodyunbornregretbeverageassurefao