Tag: "metabolic" at medical news

Duke Study Suggests New Class Of Drugs Could Bypass Leptin Loop

...in proportion, it sends a signal that elicits some metabolic response to eliminatefat," Surwit said. Leptin t...s continues, energy burned by brown fat exerts its metabolic effectson white fat -- in essence "burning" stored white fat. In demonstrating noradrenaline's fat-...

Exercise Can Help To Exorcise Stroke Risk

...as 4.5 times greater than aperson's normal resting metabolic rate, which is one kilocalorie per kilogram ofbody weight per hour. "Walking, stair-climbing and participating in moderately intense activitiessuch as dancing, bicycling and gardening were shown to reduce the risk ofstroke," says Lee. "Light activi...

Diabetes & Holiday Foods: Cedars-Sinai Physician Offers Tips To Maintain Healthy Holiday Balance

...ause of death by disease in the United States,is a metabolic disorder that affects the way the body uses and storesglucose, a form of sugar. During the holidays, people with diabetes shouldavoid an overabundance of sugary desserts and rich foods and follow aregular exercise routine, says Dr. Barnett, who leads...

Study Finds Combining Exercise With Male Hormone Therapy Benefits Men With HIV-Wasting Disease

...o 10-day periods asinpatients at the Center, where metabolic and other tests were conducted. Study co-investigators are Alison Strawford, PhD, UC Berkeley and LondonSchool of Hygiene and Tropical Medicine; Elizabeth Parks, PhD, and RichardNeese, PhD, UC Berkeley; Mark Christiansen, MD, UCSF-affiliated San ...

Magnet Therapy Eases Severe Depression, Double Blind Study Shows

...y arole in causing severe depression, altering the metabolic activities in theseareas. ECT stimulates the entire brain, is done under general anesthesia andcauses painful convulsions and memory impairment that can last several months.rTMS directs a small electrical current induced by a strong magnetic field on...

NIAID Renews Funding For Multicenter AIDS Cohort Study

...tive antiretroviral therapy (HAART), aswell as the metabolic side effects HAART produces in some individuals. "In the coming years, we are confident that MACS will keep providing criticalinformation as we pursue the best ways to treat, manage or prevent HIVinfection," says Dr. Fauci. "There is no other study ...

UK Researchers Receive Grants To Examine Benefits Of Aerobic Exercise For People With Spinal Cord Injuries

... study. Gater measures the subjects' basal metabolic rate, oxygen consumption,lipid profiles, glucose t...their ability to get around. From afunctional and metabolic standpoint, we want to find out whether endurance orstrength training is more beneficial." B...

Narcolepsy network issues national 'wake up' call

...mistaken forother disorders, such as depression, a metabolic disorder or a learningdisability," said Bob Cloud, executive director of the Narcolepsy Network. "Ourmission is to help people eliminate this unnecessary delay and get the treatmentthey need, by empowering them and their physicians with critical inf...

Walking markedly improves mental abilities of those over 60

...al regions of the brain, areas which show negative metabolic andmorphological changes during the normal aging process," Kramer said. "Cellsshrink and blood flow decreases. The benefits you get from walking are in thevarieties of cognition that show the largest age-related decline." Study participants walked ...

Oxygen reduces effects of retinal detachment

...ght-sensitivecells of the retina, have the highest metabolic rate of the body, and have onlyone source of oxygen. Separated from that, they can die very quickly. Fisher stressed that patients can use the common, everyday-use type ofoxygen mask; the therapy need not be specialized. "Patients dia...

Hypothyroidism during pregnancy linked to lower IQ for child

...tle hair; thick, coarse skin; and alowering of the metabolic rate. Studies indicate that over a 10-year period, about 3% of women of childbearingage will develop the condition. However, in many women, hypothyroidism goesundetected because they do not yet have obvious physical signs or symptoms. Only 14 of the...

Treatment of insulin resistance may have the potential to reduce long-term complications of type 2 diabetes

...siglitazone treatment may improve a whole range of metabolic abnormalities," said Dr George Bakris of the Rush ...son also has type 2 diabetes. (1) Other associated metabolic changes, such as high blood concentrations of insulin and excretion of a protein known as albumin in...

Researchers find elevated cholesterol is risk factor for preeclampsia

.... Since obesity can be associated with a number of metabolic changes, includingincreases in blood lipids [fatty substances like cholesterol and triglycerides],we examined more closely the role of obesity and elevated lipids in bothpreeclampsia and gestational hypertension." The research team identified almost...

Osteoporosis drug rapidly reduces risk of bone fractures: one year of treatmentsignificantly decreases occurence of spinal fractures

...ctive in the treatment of Paget's diseaseand other metabolic bone diseases. However, it has not been evaluated as atreatment for postmenopausal osteoporosis, a bone-weakening disease. Accordingto the National Osteoporosis Foundation, more than 50 million Americans may beaffected by osteoporosis over the next c...

CWRU medical school announces $300 million campaign

...isease, emerging infectious diseases,endocrine and metabolic diseases, epithelial/connective tissue andmusculoskeletal/connective tissue diseases, and human genetics and genomics. Theschool plans to recruit 125 new research faculty during the next decade, about a30 percent increase in research faculty. ...

Sleep debt affects metabolic functions

...hronic sleep loss can have a detrimental effect on metabolic functions, newresearch shows. "The state of sleep ... Chicago,investigated whether sleep debt can alter metabolic and hormonal functions. Eleven young men were enrolled into the study, and their carbohydrate metabo...

Lack of sleep alters hormones, metabolism

...iction and after sleeprecovery. "We found that the metabolic and endocrine changes resulting from a significantsleep debt mimic many of the hallmarks of aging," said <AHREF="http://www.ccp.uchicago.edu/faculty/Cauter_Eve_Van/">Eve Van Cauter ,Ph.D., professor of medicine at the University of Chicago an...

As key neural circuits weaken with age, our brains call upon alternate pathways to pick up the slack, study says

... that area within seconds to satisfy its increased metabolic demands--made it possible for the research team to pinpoint areas of the brain whosenerve cells were used in recalling visual patterns. Sekuler and his collaborators--Randy McIntosh of the University of Toronto andthe Baycrest Centre for Geriatric Ca...

Bristol-Meyers Squibb submits NDA for new formulation of once daily videx(R)(didanosine)

... maker of innovative therapies for cardiovascular, metabolic and infectious diseases, central nervous system and dermatological disorders, and cancer. The Company is a leader in consumer medicines, orthopaedic devices, ostomy care, wound management, nutritional supplements, infant formulas, and hair and skin ...

New quit strategy offers smokers more pleasure, less risk

... is part of a panel describing new findings in the metabolic aspects of smoking and drug abuse. Sellers' research has focused on the cytochrome P450 2A6 enzyme, which metabolizes nicotine to its inactive byproduct cotinine and activates carcinogens in tobacco smoke. By inhibiting the action of the enzyme, more...

1 2 3 4 5 6 7 8 9 10

(Date:11/24/2014)... (PRWEB) November 24, 2014 Global ... 6.19 billion by 2020, according to a new ... rates of cardiac arrhythmias clubbed with growing global ... this market. Though still in the budding stage, ... rise in usage rates in the recent times, ...
(Date:11/24/2014)... 2014 Residents of retirement communities in ... year’s SENIORS GOT TALENT, an annual online talent competition ... players to classic crooners, to seniors partying on a ... are indeed living young. , “SENIORS GOT TALENT, while ... cash prize, has always been about highlighting the vibrancy ...
(Date:11/24/2014)... York (PRWEB) November 24, 2014 The ... by the Family and Children's Association to ... as soap, shampoo, mouthwash and other such items.The Association's ... who are home bound, living in nursing homes, assisted ... to greatly enhance the well being of seniors throughout ...
(Date:11/24/2014)... SafeHandles™ announced that they will be featured ... Jr, airing via Discovery Channel. Dates and show times ... non-invasive, replaceable, and affordable germ protective device. This segment ... and adhesives to promote hand hygiene in high traffic ... SafeHandles is the desire to make a positive impact ...
(Date:11/24/2014)... Pittsburgh, PA (PRWEB) November 24, 2014 ... as he was trying to cross the street in ... "The driver never saw him. I came up with ... easily visible at night." , He developed the Safety ... night or in low-lighting conditions. The device ensures that ...
Breaking Medicine News(10 mins):Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 2Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 3Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 4Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 2Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 3Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 2Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 3Health News:New Episode of Innovations TV Series to Feature SafeHandles™ 2
Other Tags
interactivemucolipidosisregularlyace2elbowtenniscushingpituitaryusgsagigrapefruitreleasewishespacemakerafghanistanreturning