Tag: "microscopic" at medical news

Physicists find patterns within seemingly random events of physiological systems

...Arts and Sciences, research polymer systems at the microscopic level, focusing on describing the basic spatial configurations of polymer molecules so as to better predict the macroscopic behavior of polymers. Interdisciplinary science research at the Center includes studies of cardiac dynamics, the statistical ...

New ways to design safer & more effective topical (transdermal) drug delivery announced in the PNAS

...te the skin in unique ways. For example, some make microscopic holes in the SC by removing lipids. Others insert themselves in already-crowded lipid bi-layers to disorganize them. Some can also break open the dead cells in the SC and interact with the protein in those cells. CPEs that cause skin irritation are t...

In solution, tiny magnetic wires scatter light

...e various shapes," Bentley adds. Bentley calls her microscopic wires "nanowires" after nanotechnology, the booming, cutting-edge science of small. The "nano" in nanotechnology derives from the nanometer, which is equivalent to a billionth of one meter. Several types of nanoparticles are already in use, in produc...

Gene for age-related macular degeneration discovered by Yale researchers

...e. Hoh and her team used new genetic analysis and microscopic imaging technologies to find the genetic variant of the AMD gene. "What sets our study apart from previous research is that we used many more genetic markers to find the specific gene and variation," said Hoh. "Past research has involved collecting f...

2005 Wilmer Souder Award

...ential and fundamental counterpart to the electron microscopic analyses of the hybrid layer, which have received so much deserved attention. Dr. Eliades is an authority on the surface analysis of retrieved biomaterials from their in vivo host tissues. He has demonstrated the commonality of protein-precipitation ...

Cockroach allergens have greatest impact on childhood asthma in many US cities

...o water sources and food debris, house dust mites, microscopic spider-like creatures that feed on flakes of human skin, reside in bedding, carpets, upholstery, draperies and other "dust traps." Dust mite allergens are proteins that come from the digestive tracts of mites and are found in mite feces. Researchers ...

Diagnosis of prions in patients should utilize novel strategy, team says

...hods for detecting prions in human brain tissue -- microscopic examination of tissue for the telltale vacuoles that form in brain cells and immunohistochemistry (IHC), which involves detecting prions in brain sections using prion protein-specific antibodies -- may have led to an under diagnosis of the disease in...

New network of gastrointestinal immune cells discovered

...er-assisted tissue reconstruction allowed detailed microscopic examination of the intestinal tissues, which showed that dendrites extend from the dendritic cells through the epithelial layer, giving them direct access to intestinal contents. In animals without the gene required for normal dendrite growth which...

UT Southwestern researchers find calcium intake contributing factor in formation of kidney stones

...ste materials in urine do not dissolve completely, microscopic particles begin to form and over time grow into kidney stones. The most common type of kidney stone contains calcium in combination with either oxalate or phosphate, with calcium oxalate stones accounting for about 60 percent and calcium phosphate ab...

Research with red tide toxin yields potential therapies for cystic fibrosis

...itical Care Medicine. Florida red tide consists of microscopic plant-like cells that produce a potent chemical toxin that causes fish kills, contaminates shellfish, and creates severe respiratory irritation in people. As the concentration of red tide increases, waves and wind disperse toxin particles into the ai...

Stem cell therapy effectively treats heart attacks in animals

...rchers gave every treated animal between 12 and 15 microscopic injections of adult stem cells, each injection containing nearly 200 million cells. The cells were injected directly into the heart muscle using a specialized catheter inserted through a tiny puncture in an artery, a procedure similar to other card...

New tool reveals molecular signature of cancer and HIV

...uids show the ultra-sensitive test may help detect microscopic cancer and HIV drug resistance. "Other molecular tests make it very difficult to locate a mutation in a particular cell surrounded by thousands of other cells that don't have the mutation," says James Eshleman, M.D., Ph.D., who led the study with col...

Several new techniques show promise for spinal cord repair

... alignment of green cells forming myelin. Electron microscopic examination of the tissue showed that myelin was indeed produced around the axons by the transplanted cells. "These results indicate that a number of factors including remyelination of axons may contribute to improvement in function following transp...

Barbed sutures, wrinkle fillers give patients more innovative, non-surgical options

...r lasers, this laser uses light to heat and remove microscopic pinpoints of skin, promoting a more effective result and faster recovery. This new laser treatment may replace deep chemical peels and laser skin resurfacing, which often leave the skin raw and take more than a week to heal. ThermaCool o...

Chronic sinusitis sufferers have enhanced immune responses to fungi

...ion-causing immune system molecules. Airborne microscopic fungi spores abound indoors and out. People may inhale a million or more fungal spores each day, notes Dr. Kita. The mere presence of such fungi in the airways, however, is not enough to cause sinusitis because these spores can be found in the upper ...

Optics meeting tips: Internal fingerprints, no cell left behind, 3-D reality

...ical biopsy (removal of a sample of the tissue for microscopic examination by a pathologist)-the current gold standard of diagnosis-is done. So far, Bigio says, the spectroscopy results compared to pathology reports from biopsies are "promising." To make it clinically practical, he adds, diagnostic algorithms wo...

ASU researchers demonstrate new nanotech effect - moving water molecules by light

...r bubbles (which can denature proteins), or moving microscopic mechanical pump parts (which are expensive to make...been working on the problem of using light to move microscopic amounts of water around for drug delivery and microanalysis applications," said Tom Picraux. "Howeve...

New UNC, EPA 9/11 study suggests that pollutants posed small cancer risks

....5 microns were released, the scientist said. Such microscopic sooty fragments are of concern to the public health community because they penetrate deep into lungs and contain the toxic PAHs. Being products of incomplete combustion, the PAHs resulted mainly from fires fueled by 91,000 liters of jet fuel, 100,000...

Malaria: Plasmodium togetherness a strategy for breeding success

...f infectious diseases. The pathological agent is a microscopic parasite of the Plasmodium genus which develops inside the host's erythrocytes.Plasmodia go through a series of asexual reproduction cycles before a transition takes place from asexual stages to production of sexual cells, the gametocytes or pre-game...

Minimally invasive breast cancer treatment shows promise

...erative chemotherapy to shrink the tumor, residual microscopic cancer that did not show up on imaging was found around the ablated target. Although the results of the feasibility and safety study were positive, this minimally invasive procedure is currently limited as a treatment because surrounding tissue is n...

1 2 3 4

(Date:6/18/2013)... "What if adding one simple act ... your health and well-being? Well, there is something easy ... "It is called Skin Brushing ." , Skin ... lost art. Now, people are rediscovering this great health ... so do certain health conscious people. Sublime Beauty® wants ...
(Date:6/18/2013)... New York, New York (PRWEB) June 19, 2013 ... dedicated to protecting the rights of victims injured by ... on behalf of an Arizona woman who alleges that ... The suit was filed on May 30th in the ... Virginia (Civil Action No. 2:13-cv-12677) in the multidistrict litigation ...
(Date:6/18/2013)... Looking for a way to break out of the ... IWALKAWAKE is a guide to unlocking one’s true potential through ... on harnessing the powerful and abundant spiritual presence that is ... guide to finding one’s true purpose and potential. These nine ... to reach their true potential. The awakenings deal with subjects ...
(Date:6/18/2013)... Daily Gossip Magazine has always kept its readers entertained by ... The magazine has decided to prepare readers for the summer ... every week . , According to Daily Gossip ... who are looking to get insights into this type of ... food is almost entirely based on healthy, yet tasteful products. ...
(Date:6/18/2013)... 18, 2013 SEATTLE, WA—A Washington state ... Fairview, Oregon, claiming he fell ill with a hepatitis ... pomegranate seed blend. The complaint was filed in ... Clark, the Seattle-based law firm that has filed ... to the complaint, Brian Brothers consumed “Townsend Farms Organic ...
Breaking Medicine News(10 mins):Health News:The Easiest Way to Contribute to Better Health and Well-Being Starting Today and for Under $20, Says Sublime Beauty® 2Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 2Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 3Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 4Health News:Anabolic Cooking Book Review Exposes Dave Ruel’s Top 10 ‘Anabolicious’ Recipes for BodyBuilders 2Health News:Marler Clark, Washington Resident Sue Townsend Farms Over Hepatitis A 2Health News:Marler Clark, Washington Resident Sue Townsend Farms Over Hepatitis A 3
Other Tags
comparablemarimastatketektenthdarklyairwayeditsfluorideappropriationsconveysasmusualunprovengambiaopposeshivma