Tag: "multitude" at medical news

Mailman School of Public Health receives Manhattan Tobacco Cessation Center grant

... of community-academic partnerships that address a multitude of health issues. The Manhattan Tobacco Cessation Center grant builds on existing partnerships and tobacco related programs such as CAPH's Legacy Tobacco Control Evaluation Research Network and the Center for Community Health Partnership Community V...

Computational tool predicts how drugs work in cells, advancing efforts to design better medicines

...ing a reverse-engineering approach to decipher the multitude of regulatory networks operating among genes in a simple organism, then testing the ability of the resulting network models to predict gene and pathway targets for a variety of drug treatments. Finally, they used the tool to predict the molecular ta...

Elderly cancer patients are significantly under-represented in cancer clinical trials

...rogress being made in cancer research because of a multitude of barriers," said Daniel Petereit, MD, principal investigator for the project and radiation oncologist at the John T. Vucurevich Cancer Care Institute in Rapid City, South Dakota. "To address these barriers, we are working closely with Sioux Nation...

Mouse study: Signal overload in Alzheimer brains

...l over the place within the brain, responding to a multitude of signals whose identities we don't even know." Remarkably, Martin says, the stem cells were attracted to the abnormal protein bundles called amyloid plaques that cause Alzheimer's, possibly opening the door to delivering some sort of plaque-buster....

Read my lips: UCL launches centre for human communication

...ersity tells us about the complexity of biology, a multitude of languages offers insights into the complexity of the human brain. Even if not all languages can be saved, we can try to study them before they disappear and keep a record of what they were like." A one day conference to coincide with the 4th June...

Standardizing disaster models to help first responders

...hing from terrorist attacks to hurricanes. Yet the multitude of programs, incompatibility of systems as well as technical jargon in the programs themselves hinder widespread acceptance of the potentially life-saving technology. The National Institute of Standards and Technology (NIST) is working to make such m...

Protein that predicts tamoxifen resistance is identified

... how a tumor will respond to treatment. "We have a multitude of hormonally based drugs at our disposal that are designed to treat or prevent breast cancer and its recurrence," said Blackwell. "Our ultimate goal is to test tumors at the time of diagnosis to determine what their molecular signatures are and then...

Evidence that neurons prune only 'twigs' to rewire themselves

...rites are the branches of neurons that support the multitude of interconnections by which one neuron triggers a nerve impulse in its neighbors in the intricate neural pathways of the brain. The research was reported in the November 2003 issue of the journal Nature Neuroscience by Howard Hughes Medical Institut...

US DoE awards $4 million in funding to Stevens' Center for MicroChemical Systems

...g of multiphase catalytic microchannel reactors. A multitude of interrelated variables are involved; thus, the design of the microchannel reactor demands that a balance be struck among competing requirements. Computational Fluid Dynamics (CFD) simulations provide an effective means of achieving this goal, whic...

Hopkins' Peter Agre receives 2003 Nobel Prize in chemistry

...als, and have linked aberrant water transport to a multitude of human diseases and conditions. "I am so pleased that Peter has been recognized for his outstanding work on aquaporins," says Gerald Hart, Ph.D., director of biological chemistry, the division housing Agre's laboratory. "He has been part of the Joh...

College students get better grades when they take psychological principals courses

... talk," he said. "They have a multitude of assignments they have to complete on the computer that helps them put into practice what they are learning." The students had firm deadlines about when they had to submit various assi...

Laser measurements reveal biological basis of distance perception

...fed into a computer to analyze the distance to the multitude of points in the scenes. Their purpose was to discover the natural basis for a number of inherent tendencies people exhibit when asked to judge distances. These tendencies include the "specific distance tendency," in which people shown an isolated o...

Alcohol consumption increases HIV disease progression of patients receiving antiretroviral therapy

...lete cessation of antiretroviral therapy through a multitude of mechanisms." The current treatment for HIV infection, HAART, has contributed to a steady decrease in HIV morbidity and mortality. The term does not refer specifically to any particular medication, but to a minimum of three antiretroviral medicati...

Recruitment of 50,000 sisters of women with breast cancer

...dy researchers will use questionnaires to gather a multitude of data about health histories, environmental exposures and lifestyles. This comprehensive approach will allow the researchers to study new ideas regarding breast cancer while taking into account or reassessing what is already known. Beyond the in...

New Indiana University School of Medicine pediatrics program focuses on patient advocacy

...helps residents to more successfully function in a multitude and variety of roles and to better assess the needs of their patients and their environments," Dr. Downs says. Pediatric residents also will work with youngsters at the Julian Center, an Indianapolis facility serving women and children who are victim...

Welfare to work does not improve mental health

...udies have focused on women's health compared to a multitude of studies examining the economic effects of the current welfare-to-work policy." Previous studies also have shown a high correlation between stress-related illnesses, such as heart disease, high blood pressure and gastrointestinal disorders, an...

Study links one human gene to multiple diseases of old age

...nown as p21 may contribute to the development of a multitude of diseases of old age. The p21 gene serves as a brake that stops cells from growing when they are damaged by toxins or radiation, thus giving them time for repair. During normal aging, the p21 gene also stops cells from dividing as the cells...

Protein Power: 'Salt cloud' concept shows promise for developing new drugs and foods faster, at lower cost

...in size. Thistechnology could ultimately open up a multitude of applications." Membranes for mass production Current strategies for protein purification rely heavily on chromatography, inwhich a moving sample is adsorbed or bound by a stationary material, usually aporous resin in the form of small, spherica...

Biologically inspired electronics leads to higher fidelity

...candiscern the notes of a piccolo from amongst the multitude of tones in a symphonyorchestra and identify the familiar outlines of a friend in the midst of a crowdof strangers. Realizing this extraordinary ability of the neuronal networks ofthe brain to separate signal from noise led a group of researchers at...

Improved Medications Can Nip Allergy Season In The Bud

...ense, except invery severe cases. "There is such a multitude of allergens -- and people can besensitive to so many -- that it can be difficult to identify the specific agentcausing the symptoms," he explained. "It's best to explore conventional means oftreating the allergy with medication first and then, if st...

1 2

(Date:10/31/2014)... (PRWEB) October 31, 2014 Springboard ... for its small scale BioPro™ biodiesel processors, announced ... will further improve the performance and efficiency of ... GL95/MC12/BD380 trio will recover more than ... in with the glycerin by-product produced while making ...
(Date:10/31/2014)... (PRWEB) October 31, 2014 The Memory Healer ... created by Alexander Lynch, whose father suffered from Alzheimer's disease. ... dramatic moment, caused by his father's disease. His father pointed ... was the crucial moment when the author of this method ... dad. , The Memory Healer program is based on ...
(Date:10/31/2014)... Missouri (PRWEB) October 31, 2014 At ... country about families narrowly escaping carbon monoxide poisoning in ... looms just weeks away, one family-owned, Missouri-based heating and ... approach to making sure families start the home heating ... safe and secure. , Beginning Nov. 1, 2014, ...
(Date:10/31/2014)... 2014 (HealthDay News) -- Surgery for low back pain ... the United States you live, a new report says. ... back pain at some point in their lives, and ... care for a spine problem," co-author Brook Martin, of ... said in a college news release. In spinal ...
(Date:10/31/2014)... – New research suggests that insomnia is a major ... other unintentional fatal injuries. The results underscore the importance ... National Healthy Sleep Awareness Project. , Results show that ... dose-dependent manner with the number of insomnia symptoms present. ... times more likely to die from a fatal injury ...
Breaking Medicine News(10 mins):Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 2Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 3Health News:"Memory Healer" Review Reveals a New Natural Remedy Guide for Managing Memory Loss 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 3Health News:Spinal Surgery Varies by Region in U.S.: Study 2Health News:Insomnia increases risk of motor vehicle deaths, other fatal injuries 2
Other Tags
despiteeasyfrogsdeformedarrivestartpartyamokcorporateresponsibilitywalkspercentageaffectingfundsaimssporting