Tag: "needed" at medical news

Lab study: Protein delivered via genetically engineered virus slowed glioblasoma multiforme growth

... showed us that gene therapy was safe, but that we needed to design a viral vector that would harness the power of the immune system to help eliminate the tumor," commented Dr. Castro. Genetically engineered viruses are used to transport genes and/or proteins into cells and have been used in gene ther...

Dec. 7 tip sheet Annals of Internal Medicine

...ing. They conclude that "further study is urgently needed to document the safety of COX-2 inhibitors." In the meantime, they recommend that "physicians should avoid COX-2 inhibitors as a first line agent in patients with cardiovascular risk factors and average risk of gastrointestinal toxicity." This articl...

Penn epidemiological study shows difference in cardiovascular effects between Vioxx and Celebrex

...Further studies, preferably randomized trials, are needed to fully understand the spectrum of effects of COX-2 inhibitors," Kimmel adds. ...

Novel drugs help solve Gleevec resistance

...54825 and AMN107," he says. "Many more studies are needed to see how these drugs will perform." The bottom line, says Giles, is that "rational drug design is a reality and effective targeted therapies will rapidly increase in number, which means that options for patients are expanding," he says. "Prognosis ...

Farnesyl transferase inhibitor can help patients at high-risk for developing AML

...rnesyl transferase inhibitors, which block enzymes needed for the activation of cancer-promoting proteins. While the drug was initially believed to act primarily on the ras gene, which is mutated in about 25 percent of MDS patients, recent studies including this one demonstrate that patients whose ras gene ...

Nursing homes register 41 percent drop in residents' pain

...es across the country with the education and tools needed to put rapid-cycle quality improvement plans in place. The site will debut in 2006. "These results show that nursing homes can improve pain management," Teno said. "The key is to not only educate health care providers, but to change what t...

Guidance on chaperones hard to implement in general practice

...cult to implement fully. More flexible guidance is needed for general practice as well as further research into patients' views and wishes on the use of chaperones, they conclude....

Endocrine Society calls for clinical guidelines on androgens for women

...ing estrogen therapy. However, future research is needed to better understand how this therapy will impact ...well established." notes Dr. Dunaif. "Research is needed to help us identify those women who truly have testosterone deficiency and would therefore benefit f...

Imatinib (Gleevec) has activity in AIDS-related Kaposi's sarcoma

...urther research on imatinib in KS patients will be needed to determine appropriate dosing schedules." Kaposi's sarcoma is an AIDS-defining illness characterized by soft purplish lesions on the skin, mucous membranes, and internal organs. Although the incidence of KS has declined dramatically in the develo...

Mayo Clinic discovers potential marker for aggressive kidney cancer

...outcomes, hopefully, and that's what's drastically needed for this disease." ...

'Sobering' disparity: African-Americans receive less compensation for job-related back injuries

...decisions for different ethnic or racial groups is needed to better understand the disparity. "The first stage of solving a problem is identifying it. We're at that problem identification stage. Of course we now need more detailed information so that we can move toward solving the problem."...

Antibiotic rifampicin shows promise for fighting Parkinson's disease in lab tests

...nd biochemistry at UCSC. "Clearly, more work is needed to determine if this would work therapeutically, but if it does it would probably be most useful as a prophylactic therapy used in the early stages of the disease before there is general neurological damage," Fink said. The research was carried ou...

Important priorities for prevention and treatment of HIV/AIDS

...ment, a decision to add these drugs to the list is needed to help ensure greater access to substitution therapies and antiretroviral treatments, and in turn to help to bring the HIV/AIDS epidemic among IDU under control.' The final commentary paints an ominous picture for South Africa and other African c...

4 million more health workers required to improve global health

...t how 4 million extra health workers worldwide are needed if the required health improvements and millennium goals are to be met by 2015. Human resources in sub-Saharan Africa are singled out as a top priority: the authors estimate that this region needs to triple its current human resources infrastructure ...

Ugandan study highlights best drug combinations for treating malaria in Africa

...ather than clinical efficacy trials, more urgently needed are clinical studies of the effectiveness of artem...s (or failure) of the implementation process. Also needed is pressure on the UK Department for International Development, the US Agency for International Deve...

Testosterone patch will test FDA's decision making

... women's sexual difficulties, says much caution is needed in prescribing testosterone to women. Meanwhile, others have raised serious questions about the disorder because women's sexual "symptoms" may often be healthy adaptive responses and should not be regarded as evidence of dysfunction. A second ar...

University of Utah study suggests cellular waste to blame for a form of blinding eye disease

... The study also suggests additional research is needed to determine whether carbonic anhydrase inhibitors may affect vision. According to the study, "the importance of a functional CA4 for survival of photoreceptors implies that carbonic anhydrase inhibitors, which are widely used as medications, particu...

Study finds mental health needs of older adults substantially underserved

...ividuals aged 65 and older are unlikely to receive needed mental health treatment in the United States, according to a recent national study by researchers at Texas A&M University. Drawing upon data from the 2001 National Household Survey on Drug Use and Health, the researchers found that older adults were...

LA BioMed Medical/Research Briefs December 2004

...further research in a larger number of patients is needed before we can routinely recommend testosterone supplementation for men with COPD," Casaburi cautioned. To contact Dr. Casaburi, please call David Feuerherd at 310-215-0234 / 310-222-2820 or e-mail him at df@issusmanagement.com . Disquieting Repor...

What happens in the brain when we remember our own past?

...for ways to get at this feeling in the scanner. We needed a way to do it right on the spot, when the memory happened. That's where the idea of the recorders came in. I looked into it and found that a few memory researchers over the years had done this sort of diary study, but all of them used behavioral te...

1 2 3 4 5 6 7 8 9 10

(Date:11/23/2014)... BambooFlooringChina.com , the world’s leader in bamboo flooring, ... flooring collection. Now, the business is announcing big discounts ... promotion is valid until Dec. 20, 2014. , The new ... dust-free surface, which makes it very easy to maintain. As ... wants to make its website the best shopping platform for ...
(Date:11/22/2014)... (PRWEB) November 23, 2014 Cancer researchers ... a connection between intercellular communication tunnels and the growth ... the full story on the Surviving Mesothelioma website. ... and the University of Minnesota have just released their ... information and materials between cells. They found that ...
(Date:11/22/2014)... Recently, Locks-Magnetic.com , one of the successful electrical ... locks for glass doors online. In addition, the company ... products. Customers can get more information on its website. ... excellent performance. Customers who want to buy this new ... They also can enjoy the one-stop shopping experience. ...
(Date:11/22/2014)... PA (PRWEB) November 22, 2014 “Due to ... said an inventor, from Gurnee, Ill. “While using the ice ... be and I thought there needed to be a safer ... invented the SPIKE BLOCK. , The SPIKE BLOCK offers added ... so, it would help to reduce injuries and damage associated ...
(Date:11/22/2014)... PA (PRWEB) November 22, 2014 "My ... the pain caused by the machine," said an inventor ... she had to go back a second time because ... invention idea." , She developed the patent-pending MAMO EASY ... breast cancer. The design saves the patient from the ...
Breaking Medicine News(10 mins):Health News:Click Strand Woven Bamboo Flooring From Famous Bamboo Flooring Company BambooFlooringChina.com 2Health News:Study Links Cellular ‘Tunnels’ to Mesothelioma Proliferation, According to Surviving Mesothelioma 2Health News:Discounted Mag Locks for Glass Doors Revealed by Locks-Magnetic.com 2
Other Tags
bloomduecorpsesmellyvalvesimplifyarisingschrenkinsurancecirrhosiscelecoxibtooculpritfindresearchersstanford