Tag: "other" at medical news

Rhesus monkeys reason about perspectives of others in obtaining food

...ried from one person looking at the monkey and the other with their back turned, to one person having their eyes covered with cardboard and the other with only their mouth covered with cardboard. "What we are interested in is whether monkeys can rea...

Reducing hostility in young coronary artery disease patients is important piece of rehabilitation

...the study. "We believe that reducing hostility and other distress, particularly in young coronary artery disease patients, should be emphasized in rehabilitation following a heart attack." Dr. Lavie and Richard Milani, M.D., also of the Ochsner Clinic Foundation, sought to determine the prevalence of hosti...

Neurobehavioral function during coma, stroke rehabilitation effective for elderly

...itively about themselves and work and differs from other CBT programs in that it seeks to enhance social an...es. Rat study may aid in testing medications and other treatments for urinary incontinence, pg 109 This study tests the short-term effects and functional ...

Teen tooth trauma prevalent in Ontario

...ty of Dentistry. Similar studies have been done in other countries because tooth trauma is considered one of the most severe conditions children can experience. "Once you break an anterior tooth, you carry that with you for life," says Locker. "Although it can be treated, there's a likelihood you'll need t...

Brain imaging studies investigate pain reduction by hypnosis

...reas of the pain network and increased activity in other areas of the brain under hypnosis," said Sebastian...ng studies also showed increased activation in two other brain structures - the left anterior cingulate cortex and the basal ganglia. The researchers specula...

Binge drinking can impair both mood and cognitive performance

...drinking history and then assessing their mood and other cognitive abilities is unique," added Fulton T. Crews, director of the Center for Alcohol Studies at the University of North Carolina. "These individuals are not seeking treatment or aware of alcohol induced changes in their psychological make up." ...

Chemicals in tattoo inks need closer scrutiny

...pose health threats in the form of heavy metals or other potentially dangerous chemicals. Overall, the stud...ng the tattoo ink industry more closely. There are other problems with unknown compositions of tattoo inks. For example, surgery to remove tattoos is becomin...

New fingerprint visualization method uses X-rays to reveal missing clues

...t in the future, the researchers hope to integrate other spectroscopic methods besides MXRF that can detect...ore studies are planned, they say. Besides Worley, other Los Alamos investigators involved in this study include Sara S. Wiltshire, Thomasin C. Miller, Georg...

In solution, tiny magnetic wires scatter light

...her advantage that 'magnetic fluids' may have over other light-directing devices, such as mirrors, is that fluids can easily take various shapes," Bentley adds. Bentley calls her microscopic wires "nanowires" after nanotechnology, the booming, cutting-edge science of small. The "nano" in nanotechnology der...

Finances, not having a dentist are primary barriers to seniors receiving needed dental care

...eds by young seniors may be less frequent than the other senior age groups because they still are able to drive. As the loss of driving ability increases with age, so too does the need for transportation assistance to the dentist. And in rural areas, the dentist may be more than an hour away. Distance, ...

Routine dental panoramic X-rays not necessary, study shows

...aluated the X-rays for evidence of bone lesions or other abnormal appearances that would indicate trouble. The evaluators found a total of 352 lesions, and concluded that all but a few would have been picked up by full-mouth-series X-rays. The only lesions that would not have been picked up on a fu...

Study finds direct association between cardiovascular disease and periodontal bacteria

...e involved in causing periodontal disease, and the other seven serving as controls. Then, for evaluation of their cardiovascular health, the participants received a carotid intima-media thickness (IMT) measurement and provided a blood sample to determine their C-reactive protein levels. C-reactive protein ...

Forensic dentistry key in identifying victims of tsunamis, other disasters

...ion for comparison with dental records. Therefore, other diagnostic approaches have been developed. Traces of saliva and fragments of teeth and bone may be a valuable source of DNA evidence, offering new probes to solve unanswered questions and clarify unusual cases. Craniofacial reconstruction is another ...

Age shouldn't be a factor in kidney transplantation

...lants are age 50 or older. Wake Forest Baptist and other centers are grappling with how to best use the limited number of kidneys that are available each year from deceased donors. "There is a critical shortage of kidneys for transplantation, which puts us in the difficult situation of rationing organs," s...

Philanthropist Paul F. Glenn launches labs for aging research at Harvard Medical School

... programs and through important relationships with other institutions focused on understanding the molecular biology of aging and mechanisms that govern the pace at which normal individuals experience physiological decline and disease. "As we mark our 40th anniversary, we are very excited to establish thi...

Nursing mothers having surgery -- How long a wait to breastfeed safely?

... part of a conscious sedation technique along with other intravenously administered agents, including a narcotic for pain and a benzodiazepine for amnesia. The Northwestern researchers found that less than 0.1 percent of the dose of propofol used to put the patient to sleep appeared in her breast milk wit...

ENDO 2005 - The Endocrine Society's 87th annual meeting

...he meeting.Information about press conferences and other media events planned for ENDO 2005 will be available in The Society's Online Press Room in spring 2005. Check http://www.endo-society.org/media/pressroom.cfm for more information...

Rasagiline reduces disability for patients with advanced Parkinson's disease

...o use for both patient and the clinician than most other additional therapies."...

Tumor-targeted immune cells cure prostate cancer in mice without causing systemic immune suppression

...as had been the case in earlier studies by Lee and other researchers. "To the best of our knowledge, studies to test this concept have not been attempted before," Lee said. In summary, these CD8+ T cells were specifically reactive against tumor tissues. Second, they were insensitive to TGF-beta. The tw...

Teen athletes continue tobacco use, despite severe consequences

...rchers concluded that: tobacco use is a marker for other poor oral health behavior (e.g., alcohol use) that may increase students' risk of developing oral lesions, and oral health care providers should perform routine oral screenings in this group; and students' attitudes toward tobacco use are affected by...

1 2 3 4 5 6 7 8 9 10

(Date:5/18/2013)... Family Magazine of Washington DC was awarded the "Best ... Inc. in the category of Summer Camps in DC ... the areas best in the ultimate guide on parenting, kids ... Brenda Hyde, a mother of four and publisher of Family ... vast resources available to them in the DC Metro area. ...
(Date:5/18/2013)... (PRWEB) May 18, 2013 During Better ... loss should consider the legal protections they have, including ... problems arise with their child’s treatment or hearing aid ... Since 1927, the American Speech-Language-Hearing Association has used the ... and to promote treatment, such as cochlear implants, which ...
(Date:5/18/2013)... 18, 2013 Simple changes in a ... snacks and drinking more water can lead to substantial ... a healthier lifestyle overall. Diet Doc understands ... weight loss can be difficult and often requires the ... plans to help patients get over initial weight loss ...
(Date:5/18/2013)... 2013 6Webs.com is the leader in ... reviews and comprehensive comparisons make 6Webs.com the useful resource ... 6Webs.com just recently finished conducting their assessments of the ... Smythe from 6Webs.com reports, "There has been an increase ... ease of use, expandability and mobility. Combine these features ...
(Date:5/18/2013)... Show And Go Training, the culmination of ... systems that is all about is getting results in the ... http://ShowAndGoTrainingReview.com ’s Stan Stevenson, prompting an investigative review. ... “four phase system” designed to make you faster, stronger, fitter ... working out in the gym. The training manual and exercise ...
Breaking Medicine News(10 mins):Health News:Summer Camps in DC "Best of the Best" Awarded to Family Magazine of Washington DC for Excellence by Follow Media Consulting, Inc. 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 3Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 2Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 3Health News:Best Wireless Home Security System Companies Released by 6Webs.com 2Health News:Show And Go Training: Review Examining Eric Cressy's Workout Program Revealed 2
Other Tags
sarawakmalaysianweevilnicetrendupwardpredisposingemphasiscouricmovieadvisestraymitigatesolicitousnessgastroenteritisgatorade