Tag: "patients" at medical news

Study shows risk of cardiac death after radiation for breast cancer has dramatically decreased

...ortality after 15 years (13.1 percent) compared to patients with tumors on the right side (10.2 percent). Howe...l need to be continued to confirm that the risk to patients has been completely eliminated. According to the study, in 2002 approximately 42 percent of breast c...

American Thoracic Society Journal news tips for March 2005 (second issue)

...GREATER IN LESS SEVERELY ILL In a large cohort of patients from 5 intensive care units (ICUs), patients who developed bloodstream infections while in the unit were 7 times more likely to die that those wh...

Mayo Clinic discovers 'new pathway' against pancreatic cancer

...ep toward developing new and better treatments for patients with pancreatic cancer. "This is a very exciting -...cer deaths in the United States. Pancreatic cancer patients have one of the poorest prognoses -- the five-year survival rate is 3 percent. Because pancreatic ca...

Community care tops medical care at preventing heart disease in black Americans

..., is the first to test which model works best when patients have equal and unrestricted access to health care ...ity health worker is far more effective at helping patients lower their risk factors than the standard in which patients are on their own to follow - or not fol...

Fixing of the lumbar column aided by simple radiological techniques

...mical references. The study has been applied to 44 patients attending the University Hospital. The insertion of pedicular screws into the lumbar vertebral column is suitable for the treatment of fractures, problems of instability due to degenerative illness, tumours, etc. It involves a routine technique in or...

Helping answer needs by developing specialists in autism

...ana. It also provides consultation and services to patients from Illinois, Michigan, Ohio and Kentucky. U.S. Rep. Dan Burton of Indiana was instrumental in securing funding to establish the center. It is estimated that 38,000 Hoosier children have autism, according to a source at the Autism Society of Indiana...

Balance and better interactions between primary-care and specialist physicians improve US health

...s would negatively impact communities because more patients would be seen by specialists and would be more lik...., specialists typically work in hospitals and see patients only on referral from primary-care physicians, so that the roles are clearly delineated. In the U.S....

Epstein-Barr virus protein crucial to its role in blood cancers

...rative disease in transplant and immunocompromised patients because this is a clear case of EBV-driven B-cell lymphoma. The use of peptides to block the interaction between this essential EBV protein and the specific pathway in human B cells is currently underway. Initial studies show that the growth of EBV...

Prostate cancer screening practices examined

...cerous growth. The outcome of the study should aid patients and doctors in making decisions about diagnosis and treatment of prostate cancer. "It's a complex decision," Andriole explains. "Say your father had an abnormal PSA test, and he's 76 and has a bad heart, diabetes, or recently had a stroke. Frankly, t...

GlaxoSmithKline receives unanimous favorable recommendation by FDA Advisory Committee for Boostrix

...than seven days, approximately 20 percent of these patients had laboratory-documented pertussis. In addition to the public health threat pertussis poses, the disease also has economic repercussions. A cost-benefit analysis for the use of a pertussis booster vaccine in adolescents projected that vaccinatio...

Dealing with conflict in caring for the dying patient

...tant because many family members of critically ill patients often have a lot of anxiety, sadness and frustration over their loved one's situation. Finally, using a step-wise approach, the authors recommend the following course of action if a dispute should erupt over patient care. The first step is to recogn...

Government wasting your taxpayer money on ineffective drug cure

...nitine. "L-carnitine is offered as a supplement to patients on chronic hemodialysis to help correct the anemia associated with chronic kidney disease, to help prevent a drop in blood pressure during the hemodialysis treatment, and to improve heart function," states Dr. Steinman. "The studies done on this sup...

Study of obese diabetics explains why low-carb diets produce fast results

...om. The research was conducted in a group of obese patients with type 2 diabetes who followed the Atkins diet....sured. After a week of typical eating, ten obese patients with type 2 diabetes followed the Atkins diet for two weeks, with carbohydrates limited to 20 grams ...

Annals of Internal Medicine tip sheet for March 15, 2005

...rent approaches to food restriction for individual patients at different times in their efforts to lose weight may be the most effective way a clinician can use the available diets." (This article is the subject of a video news release. Please call for coordinates.) 2. Borderline Risk Factors Account for O...

Researchers say breast cancer in Africa may provide clues to the disease in African-Americans

...can American and Sub-Saharan African breast cancer patients suggests the possible effects of hereditary factors, and these influences may cause the younger age distribution that is seen among these patient populations to persist."...

Medicaid enrollment at late stages may partly explain poor outcomes for cancer

...ociety, says the poorest outcomes are among cancer patients who enroll in Medicaid after diagnosis. These indi...or instance, that Medicaid-supported breast cancer patients have similarly poor outcomes to uninsured patients. However, there is little research to explain the...

Simple blood test may help to predict cardiovascular risk in older women

...has been proposed as a way to identify and monitor patients at risk for coronary heart disease. The authors st...r at the same time allows better classification of patients as to whether they have inflammation, " "It is reassuring to see continuing study of simple and wel...

Obesity among African-American stroke survivors increases risk factors for recurrent stroke

...and colleagues analyzed data from African-American patients enrolled in a study of treatment for prevention of...quare of height in meters) for 1,711 patients. The patients were divided into six groups, underweight (BMI less than 18.5), normal weight (BMI 18.5 24.9), over...

Depression may explain higher risk of heart attack associated with antidepressants

...rom 644 general practices across the UK, on 60,000 patients who had had their first heart attack between 1998 ... have a heart attack within the next seven days as patients who had not been prescribed these drugs. And patients prescribed the newer class of selective seroto...

New study shows how very low-carb diets take off the pounds

...rent approaches to food restriction for individual patients at different times in their efforts to lose weight may be the most effective way a clinician can use the available diets. (I) am not yet convinced that one diet has any more value than another -- they all have value." Annals of Internal Medicine is...

1 2 3 4 5 6 7 8 9 10

(Date:7/25/2014)... (PRWEB) July 25, 2014 AttorneyOne.com, a recognized ... latest information from the FDA on Ibuprofen and Oxcarbazepine ... that one lot of Ibuprofen and one lot of Oxcarbazepine ... due to mislabeled packaging. Oxcarbazepine is used for the treatment ... , The reason for the recall is that Lot ...
(Date:7/25/2014)... July 25, 2014 Parker Waichman LLP, ... of consumers comments on a recent tobacco lawsuit in ... smoker $23.6 billion in punitive damages. Cynthia Robinson brought ... cigarettes. The case is Cynthia Robinson v. R.J. Reynolds ... Florida First Circuit Court, Escambia County, Florida; Case Number ...
(Date:7/25/2014)... Drexel University College of Medicine is pleased ... been appointed vice dean for education, effective October 1, 2014. ... Medical College, where she is currently chair of the Department ... of medicine. , As a member of the senior ... major role in many aspects of the development of the ...
(Date:7/25/2014)... vulnerable neurons and reduce motor deficits in a ... University School of Medicine have shown. , The ... Parkinson,s Disease . , The findings demonstrate that ... at sufficient levels and have beneficial effects when ... Previous studies of XPro1595 in animals tested more ...
(Date:7/25/2014)... 25, 2014 The new report ... Feed, Pharmaceuticals and Others), by Type (Amylases, Cellulases, ... Geography - Global Trends & Forecasts to 2019", ... of the global Carbohydrase market with analysis of ... is segmented and values are forecasted on the ...
Breaking Medicine News(10 mins):Health News:Ibuprofen and Oxcarbazepine Tablets Recalled: AttorneyOne Monitors and Keep Consumers Informed 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 3Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 2Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 3Health News:Anti-inflammatory drug can prevent neuron loss in Parkinson's model 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 3Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement