Tag: "pollution" at medical news

Study of energy and health in Africa focuses spotlight on charcoal and forest management

...an Africa) from respiratory diseases caused by the pollution from such fires, according to previous studies by ...n to clean charcoal without drastically increasing pollution and decimating tropical forests would be an excellent way to help achieve several of the United Nati...

Charcoal and forest management could reduce greenhouse gas levels & save lives in Africa

...an Africa) from respiratory diseases caused by the pollution from such fires. The study finds that smoke from w...ple consequences, including preventable deaths and pollution emissions. Decisions made now or in the near future are going to have large effects on health and en...

Major review of subway systems suggests potential for significant health and safety hazards

...er safety hazards as well, including injuries, air pollution and vibration. Findings of the report, "Health and Safety Hazards Associated with Subways," by Dr. Gershon will appear in the March Journal of Urban Health, a publication of the New York Academy of Medicine. Also in the March issue, Steven Chillrud,...

Air pollution thickens the blood

...mental Medicine . This may help to explain why air pollution is associated with an increased risk of heart attacks, stroke, and worsening respiratory problems. The research team tested the inflammatory and blood clotting responses of human immune cell (macrophages) and umbilical cord and lung cells, six and 24...

Mothers' exposure to air pollutants linked to chromosome damage in babies

... expectant mothers to combustion-related urban air pollution may alter the structure of babies' chromosomes whi...searchers then calculated the concentration of air pollution to which each pregnant woman and her baby were exposed. Study participants exposed to air pollution ...

Satellite data reveal immense pollution pool over Bihar, India

...data have discovered an immense wintertime pool of pollution over the northern Indian state of Bihar. Blanketi...illion people, primarily in the Ganges Valley, the pollution levels are about five times larger than those typically found over Los Angeles. The discovery was ma...

Day-long drivers at risk of cardiovascular problems as a result of traffic pollution

...ects of different sources of motor vehicle-related pollution on patrol officers. State troopers were chosen bec...lotting status. The results of the study show that pollution from speed-changing traffic had the most significant impact on the markers of cardiovascular health ...

Innovative take-off system could lead to safer, cleaner air travel

...nning, the system would also reduce noise and fuel pollution affecting people living close to airports, and could save thousands of litres of aviation fuel. The research could lead to a computer-based system that helps runway controllers make quick but effective scheduling decisions, generating a 10-25% reduc...

Impact of 2002 Canadian forest fires felt 700 miles away in Baltimore, Maryland

...amatic example of the significance that global air pollution has, not only on the outdoor air quality in our co...indoors at home offered little protection from the pollution episode. At the peak of the episode, PM2.5 levels as high as 366 ug/m3 were recorded inside. The res...

Hong Kong think tank calls for pollution standards

...standards for fine particulate matter. Much of the pollution can be tied to the Chinese export market, which ma... and other markets. "About 20 to 30 percent of the pollution in the region is due to manufacturing goods for export," said David Streets, a senior scientist at A...

American Thoracic Society journal news tips for November 2004 (second issue)

...the most toxic components of the photochemical air pollution mixture.) For this study, data on mortality, including natural, cardiovascular, and respiratory death rates, was obtained from 23 European cities covering at least a three-year time period. According to the authors, in 19 of 23 cities, ozone was fo...

Respiratory infections, not air pollution, pose winter health threat for children with asthma

Although particulate air pollution has been blamed for a wide variety of negative hea...sthma exacerbations. "In our study, wintertime air pollution had no significant effect on asthma exacerbations or lung function," said Nathan Rabinovitch, M.D., ...

Air pollution may cause and speed up artery disease

NEW ORLEANS, Nov. 7 Air pollution may trigger and accelerate narrowing of carotid ar...archers found an association between long-term air pollution exposure and the early stages of atherosclerosis (hardening of the arteries). "We knew that people i...

Scripps atmospheric scientist appointed to Pontifical Academy of Sciences

...e combines with the atmospheric brown cloud of air pollution that Ramanathan and his collaborators discovered. We now can see a direct relationship between pollution, climate change and human health. Climate change affects every human being on earth and all its living things. It is entirely fitting that the Po...

Envisat Symposium report day 4: Assistance from space to combat hazards and natural disasters

...e and Technology. Research on satellite-based oil pollution detection was also presented, along with information on ESA's current work as co-chair of the Integrated Global Observing Strategy's Geohazards Theme, a move by a partnership of international bodies concerned with environmental change issues, to forg...

Envisat Symposium report day 2: GMES turns science to services

...ing MERIS results for purposes such as identifying pollution or biological content of coastal waters. The day concluded with a round table on ESA's TIGER programme, dedicated to applying Earth Observation to the problem of water management in Africa. Several ESA-run TIGER projects are already well advanced, i...

Taking apart a hurricane: Multi-sensor Envisat sees through Frances

...f the Antarctic ozone hole, the Bam earthquake and pollution in Europe. Numerous demonstrations are planned during the week in the ESA Exhibit area. An industrial consortium exhibit on the joint ESA-European Commission Global Monitoring for Environment and Security (GMES) initiative is also planned....

Envisat witnesses return of the South Polar ozone hole

...f the Antarctic ozone hole, the Bam earthquake and pollution in Europe. Numerous demonstrations are planned during the week in the ESA Exhibit area. An industrial consortium exhibit on the joint ESA-European Commission Global Monitoring for Environment and Security (GMES) initiative is also planned....

Scientists meet to review Envisat results after two and a half years of operations

...ince the launch of Envisat, the Bam earthquake and pollution in Europe. Numerous demonstrations are planned dur...ernment programmes in the fields of global change, pollution and disaster monitoring, and commercial applications....

Siberian forest fires partly to blame for Seattle area violating EPA ozone limit

... considered that long-range transport can bring in pollution levels that are significant," Jaffe said. "What we're finding is that these events can bring in significant levels of pollution, even to urban areas where the levels already are relatively high." In the spring and summer of 2003, Siberian forest fir...

1 2 3 4 5

(Date:4/18/2014)... scientists could lead to potential new treatments for breaking ... , Fibrosis, or scarring, is a hallmark of ... lungs can lead to serious organ damage and, in ... options centers on findings made by Swati Bhattacharyya, PhD, ... that a specific protein plays in promoting fibrosis. ...
(Date:4/17/2014)... popular vaccine brands for children may not be the ... cost factors when choosing vaccines, driving the market toward ... a new study by University of Illinois researchers. , ... by numerous factors," says Sheldon H. Jacobson, a co-author ... and of mathematics at the U. of I. "In ...
(Date:4/17/2014)... NY In a review published in the April ... president of The Feinstein Institute for Medical Research, says ... medical community,s approach to treating sepsis, which ... Americans. , Sepsis occurs when molecules released into the ... throughout the body. Inflammation is necessary for maintaining good ...
(Date:4/17/2014)... many as 10 million older Americans suffer from depression, ... , However, new research a project that followed ... six years found that Internet use among the ... than 30 percent. , "That,s a very strong effect," ... telecommunication, information studies and media who led the project. ...
(Date:4/17/2014)... 17, 2014 EcoHealth Alliance, a nonprofit organization that ... a comprehensive review today examining the current state of ... review calls for improved global surveillance strategies to combat ... outbreak of Ebola in West Africa that has claimed ... Guinea and Liberia. According to the World Health ...
Breaking Medicine News(10 mins):Health News:New clues on tissue scarring in scleroderma 2Health News:Study recalculates costs of combination vaccines 2Health News:Feinstein Institute researcher publishes new perspective on sepsis 2Health News:Internet use can help ward off depression among elderly 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 3
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue