The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "properties" at medical news

UIC chemists synthesize potent anticancer compound

An intricate molecule with exciting anticancer properties that is found only in minute amounts in a few species of South Pacific sponges has for the first time been synthesized in the laboratory by UIC chemists. The 50-step, atom-by-atom assembly, reported in the Nov. 8 issue of the Journal of the American ...

Sushi condiment may prevent cavities

... properties. In addition, wasabi has antimicrobial properties - which may account for its popularity as an accompaniment to raw fish. Wasabi, or Wasabia japonica, is a perennial plant from the Cruciferous family, which includes broccoli and cabbage. Wasabi's thick stems are ground into a pale-green past...

Cotton clothes carry fungal spores into hospitals

...ls. Specifically, they sought to identify textile properties that influence the retention and release of fungal spores on contaminated fabrics. Their work was presented to the American Society for Testing and Materials in Seattle in 1999, and is published in the book Performance of Protective Clothing: Issue...

Toward a better burger: "Where's the selenium?"

...ow the selenium in beef to have similar biological properties to other forms of selenium, then beef produced in these (high selenium) areas could conceivably be marketed as a specialty product, thus enhancing value for consumers and profitability to producers," Finley said. While red meat has been widely implic...

Aspirin and other non-specific COX inhibitors may slow atherosclerosis

...g illnesses such as arthritis. But because of the properties of prostacyclin, FitzGerald and his colleagues wondered whether blocking this COX-2 product might lead to hardening of the arteries, particularly in young patients with juvenile arthritis who might take the drug for long periods. Using mice that had ...

Polymer research could lead to better protective clothing

...y the stacked cyclodextrins. "We like to study the properties of these individual polymer chains that are trapped inside. How is that behavior different from when you have a collection of polymer chains?" Tonelli said. Learning more about the behaviors of long-chain polymers could enable scientists to develop c...

Animal studies indicate new approach for treating end-stage skin and kidney cancers

... showed that the compound enhances the anti-cancer properties of IL-2 therapy. IL-2 immunotherapy, which works b...e effectively reproduces the free-radical fighting properties of the natural SOD enzyme, which has been found to be deficient in cancer states. When in excess,...

South Pasadena chemist wins national award for designing new catalysts

...in. The result is a polymer whose chain length and properties are tailor-made, said Grubbs, adding that such materials could make pipes for corrosive environments - golf clubs and bats, for example. He is also working in basic pharmaceutical research, Grubbs added: "We're trying to find new ways to put the carb...

Undergraduate conducts high-tech tests on dental enamel

...el. The device allowed Braly to measure mechanical properties of tooth enamel, including stiffness (how easily t...hopes to learn more about why enamel has different properties in different areas of a tooth. "We're trying to find out if it has something to do with the molecula...

New materials could mean longer lasting artificial hips

...to find new materials that have similar mechanical properties but are a lot less hydrophobic." He is currently investigating polyethylene derivatives....

Science, engineering and technology newstips

...iboride is a metal which seems to have encouraging properties for some applications, said Pickett. After hearing of the discovery, Pickett's lab began to model the behavior of magnesium diboride crystals, which are made up of alternating layers of magnesium and boron atoms. They found that while the atoms in e...

Yale researchers create topical estrogen that alleviates sexual dysfunction in menopausal women and eliminates side effects of conventional estrogen

...nt. "This new topical estrogen has some anti-aging properties and may alleviate some of the symptoms of aging skin," he said....

Methadone promotes HIV infection in cell culture

...ic opiate that shares many biological and chemical properties with morphine and heroin. "Because methadone has been shown to reduce human immune responses, we decided to study its effects on HIV infection of human immune cells," said Wen-Zhe Ho, M.D., an immunology researcher at Childrens Hospital, who presente...

MetaPhore Pharmaceuticals initiates Phase I clinical trial of enzyme mimetic compound for oncology

... the enzyme mimetic enhances the direct anti-tumor properties of IL-2 therapy. Based on these encouraging preclinical results, the SOD enzyme mimetic may offer improved therapeutic options for end-stage cancer patients, with a greatly reduced side-effect profile, added Dr. Wolfram Samlowski, one of MetaPhores...

Crystallographers meet in Los Angeles

...aventure Hotel in Los Angeles. The science of the properties and formation of crystals, crystallography, provides much of the basis for the modern sciences of chemistry and molecular biology. Among other things, crystallographers study the detailed atomic arrangements of protein crystals which gives research...

Spaghetti gets protein boost from corn gluten meal

...lso increase A and B vitamin content, Wu said. The properties of a new spaghetti would be useful to a number of people, he added. There is increasing interest, especially among vegetarians and health-conscious people, for protein-enriched foods with no cholesterol and low saturated fat contents, he said. We thi...

Uncovering tumors, hidden subs, and cracks in airplanes using math

...e a range of problems including using the elastic properties of tissue to detect tumors in the human body with a branch of mathematics known as inverse problems. The recipients of the grant are: Joyce McLaughlin, Ford Foundation Professor of Mathematical Sciences; Margaret Cheney, professor of mathematics; An...

Scientists image material that could improve MRI technologies

... researchers first need to understand the physical properties of these materials and especially how they behave ... their method revealed new electrical and physical properties that the researchers did not expect to find. They learned that the electrons behave very differently...

Study suggests mechanical forces drive early heart development

...ople are going to be looking at how the mechanical properties of the heart change as it develops," Taber says. "The active properties of heart tissue cause shape changes, as well as cause the heart to beat and pump blood. Until we ha...

Four researchers awarded Dutch Nobel Prize

...ool. This means that the genetic expression of the properties which help determine intelligence takes place at a...synthesis of complex molecules with the functional properties of polymers. Meijer is a leading scientist in the field of the design, synthesis and characterisati...

1 2 3 4 5 6 7 8 9 10

(Date:11/21/2008)...Newswire-USNewswire/ -- New research at West Virg... spitless tobacco product aimed at young adults is...RJ Reynolds, Camel Snus - touted as a socially acc...singly high levels of nicotine. , , "Camel ...products," said Bruce Adkins of the state Division...
(Date:11/21/2008)...swire-USNewswire/ -- U.S. News & World Report ...NCQA) ranked BlueChoice(R) HealthPlan of South Car...ans(TM), published in U.S. News & World Report...l ranking ranks the nation,s best health plans bas...QA accreditation scores. NCQA and U.S. News & ...
(Date:11/21/2008)...swire-FirstCall/ -- Barr Pharmaceuticals, Inc. (NY...overwhelmingly approved the proposals submitted to...Pharmaceuticals Industries Ltd. (Nasdaq: TEVA )....elming support of the transaction by the Barr shar...nd CEO. "We are pleased with the progress that we ...
(Date:11/21/2008)...y diseaseits cause remains a mysteryswept into Ath...citizens, soldiers and refugees of the war then ra...with corpses, social order broke down. Over the ne...ens lost a third of its population. It lost the wa...f the end of the Golden Age of Greece. , The Pl...
Breaking Medicine News(10 mins):Health News:Experts Say New Tobacco Product Targets Young Adults 2Health News:Experts Say New Tobacco Product Targets Young Adults 3Health News:BlueChoice HealthPlan Ranks in Top Third of America's Best Health Plans 2Health News:Barr Shareholders Approve Pending Teva Acquisition 2Health News:Barr Shareholders Approve Pending Teva Acquisition 3Health News:Barr Shareholders Approve Pending Teva Acquisition 4Health News:Study of ancient and modern plagues finds common features 2Health News:Study of ancient and modern plagues finds common features 3Health News:Study of ancient and modern plagues finds common features 4
Other Tagsalleviate 2alleviate 3alleviate 4alters 2alters 3alters 4alters 5alters 6alters 7orchestrates 2survived 2survived 3survived 4survived 5survived 6survived 7survived 8survived 9survived 10worsens 2smoke 2smoke 3smoke 4smoke 5smoke 6smoke 7smoke 8smoke 9smoke 10cigarette 2cigarette 3cigarette 4cigarette 5cigarette 6cigarette 7cigarette 8cigarette 9cigarette 10month 2month 3month 4month 5month 6month 7month 8month 9month 10rewarding 2
alleviatealtersorchestratesjudesnowballsurvivedsmearspapworsenssmokecigarettemonthyipsspellsrewardingmagnifies