The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "reactions" at medical news

Ph.D. Degree Research Results In Patent For Low-Cost Pharmaceutical Filters Made From Seafood Waste

...working with cellulose. So Todd did his masters on reactions ofcellulose in solution. "We learned of some limitations of cellulose gel beadsthat we hypothesized could be avoided by working with chitin, a close cousin ofcellulose," says Glasser. "What cellulose is to trees chitin is to marineorganisms; they are...

ENBREL (Etanercept) Receives FDA Approval For Treatment Of Juvenile Rheumatoid Arthritis

...al studies some patientsexperienced injection site reactions (37 percent), infections (35 percent),headache (17 percent), and malignancies (less than 1 percent). With theexception of injection site reactions, the adverse event rate over time wassimilar for patients receiving ENBREL or placebo. In children, i...

New Concepts Proposed To Investigate Drug Reactions

... says that the leading theory on thecause of these reactions -- that the drug irreversibly binds to proteins or... lead to a better understanding ofhypersensitivity reactions which in turn could lead to the development of teststo predict which drugs will be associated with s...

Stimulating growth hormone production in older adults can reduce body fat and increase hormone levels

...hough a fewpatients noted fluid retention or local reactions at the injection site. The investigators caution that these early results do not mean thatgrowth hormone or GHRH should now be recommended as routine treatment or aspreventive medicine. Much more work, including completion of this study and a...

Older, disabled women have trouble managing pain

...unt for the low doseobservation, including adverse reactions to some of the drugs or theineffectiveness of previous or current treatment. "We need to find out moreabout why older women are taking such minimum, and possibly ineffective, dosesof medication," said Pahor. The NIA, part of the National Institutes ...

Clues to heart disease seen in cholesterol reactions to stress

...estigation because men generally have greaterlipid reactions to stressors than do women and because family history of heartattack is particularly predictive of mortality among men," Stoney said. In the study, 22 college-aged men with no parental history of heart attack and15 men with one or both parents who ...

ENBREL application for early, active rheumatoid arthritis filed with the U.S. Food and Drug Administration

...ceiving ENBREL were mild tomoderate injection site reactions (34 percent) that did not complicatetreatment. ...teins that play an important role in thecascade of reactions that cause the inflammatory process of RA. ENBRELcompetitively inhibits the binding of TNF molecule...

Infant pain may have long-term effects

... to induce significant physiological andbehavioral reactions in newborn infants, even those born prematurely," said FranLang Porter, PhD, lead author of the research. "There is now evidence thatthese early events not only induce acute changes, but that permanent structuraland functional changes may also resul...

'Sun-glasses' in the eye

...d that the activationof mGluR8 triggers a chain of reactions leading to a decrease in the calciumconcentration in the photoreceptor cells. The Frankfurt group concludes fromthis that the activation of mGluR8 leads to a downregulation of glutamate release from the photoreceptor cells, because calcium concentrat...

University of Pittsburgh, Carnegie Mellon University to share $10 million NIH grant to study mind-body relationships

...udes and coping responses as well as physiological reactions to the stress in their lives as potential markers of risk for cardiovascular disease; and Researchers hope to learn whether psychosocial interventions can be designed to enhance adjustment and lower recurrence and mortality among women with early- ...

Novel neurotransmitter overturns laws of biology, offers potential for stroke treatment

...yder says, when lack of oxygen in tissues triggers reactions that greatly overstimulate the NMDA receptor. Overstimulation triggers reactions that destroy nerve cells. "Being able to turn off or turn down the receptors might prevent damage," ...

ENBREL (etanercept) long-term clinical trial data

...n rheumatoid arthritis (n=349) were injection site reactions (ISR) 37%, infections (35%) and headache (17%). M...outpatient pediatric populations. Serious adverse reactions reported rarely were varicella (3%), gastroenteritis (3%), depression/personality disorder (1%), cut...

AAPS applauds FDA efforts to expand monitoring of dietary supplements

...d FDA's announcement to expand tracking of serious reactions to herbs, vitamins and other dietary supplements and to set new manufacturing standards for the $13 billion nutraceutical industry. "AAPS supports FDA's plans to expand its tracking efforts and calls Congress to provide the FDA with the funding re...

Teasing out the early steps of neurodegeneration

...s a possible commonality among the diseases in the reactions of brain cells to earlier malfunctions. In comparing the gene expression profiles from their mouse model to gene expression in human tissue from SCA1 patients, Zoghbi and her colleagues found similarities in the patterns of expression of the affect...

Expert calls for common sense, science in national response to medicinal herbs

... news media have blown stories about negative drug reactions involving herbs out of proportion to reality because "negative stories sell newspapers." Too often journalists, physicians and scientists have been unaware of -- or disregarded -- the scientifically valid clinical trials of various herbs that have al...

Conference to examine nutritional supplements, medicinal herbs for managing health problems

...nd nutritional supplement interactions and adverse reactions at 1 p.m. Dr. Varro Tyler, dean of pharmacy emeritus at Purdue University, will speak on "Laws and Regulations Governing Medicinal Herbs: Their Effect on Current and Future Markets" at 2 p.m. Workshops will follow. On Sunday at 8:30 a.m., Dr. Keith ...

Making kidney transplants last longer: Large UM study finds newer drug is better

...the transplanted organ and because of other immune reactions caused by the mismatch of the recipient's antibodies to proteins on the surface of the new kidney's cells. Protecting against chronic organ failure is important to the individual patient, and to the entire population of transplant candidates. Ther...

Parenting, stress and your child's risk for alcoholism

... alter the hormonal stress response and subsequent reactions to new stressors. Pohorecky believes the study's results are relevant to the role played by parents, as well as their presence, in their children's lives. "These findings speak to the importance of how society handles children who have problems, fam...

Humans can regrow liver from bone marrow

...he said. Because the liver also performs complex reactions such as protein manufacture and chemical detoxification, bile-producing artificial livers need a living component to replace the damaged organ completely. "Liver cells, ironically, are hard to grow in culture. But stem cells should be much easier," h...

Product design and drug development breakthroughs help the environment

...earchers to create pharmaceuticals using very mild reactions that work in room temperature water solutions, ins...quid waste as well as potentially harmful chemical reactions associated with the original production process, while increasing the product yield by more than 25 ...

1 2 3 4 5 6 7 8 9 10

(Date:11/21/2008)...Newswire-USNewswire/ -- New research at West Virg... spitless tobacco product aimed at young adults is...RJ Reynolds, Camel Snus - touted as a socially acc...singly high levels of nicotine. , , "Camel ...products," said Bruce Adkins of the state Division...
(Date:11/21/2008)...swire-USNewswire/ -- U.S. News & World Report ...NCQA) ranked BlueChoice(R) HealthPlan of South Car...ans(TM), published in U.S. News & World Report...l ranking ranks the nation,s best health plans bas...QA accreditation scores. NCQA and U.S. News & ...
(Date:11/21/2008)...swire-FirstCall/ -- Barr Pharmaceuticals, Inc. (NY...overwhelmingly approved the proposals submitted to...Pharmaceuticals Industries Ltd. (Nasdaq: TEVA )....elming support of the transaction by the Barr shar...nd CEO. "We are pleased with the progress that we ...
(Date:11/21/2008)...y diseaseits cause remains a mysteryswept into Ath...citizens, soldiers and refugees of the war then ra...with corpses, social order broke down. Over the ne...ens lost a third of its population. It lost the wa...f the end of the Golden Age of Greece. , The Pl...
Breaking Medicine News(10 mins):Health News:Experts Say New Tobacco Product Targets Young Adults 2Health News:Experts Say New Tobacco Product Targets Young Adults 3Health News:BlueChoice HealthPlan Ranks in Top Third of America's Best Health Plans 2Health News:Barr Shareholders Approve Pending Teva Acquisition 2Health News:Barr Shareholders Approve Pending Teva Acquisition 3Health News:Barr Shareholders Approve Pending Teva Acquisition 4Health News:Study of ancient and modern plagues finds common features 2Health News:Study of ancient and modern plagues finds common features 3Health News:Study of ancient and modern plagues finds common features 4
Other Tagsalleviate 2alleviate 3alleviate 4alters 2alters 3alters 4alters 5alters 6alters 7orchestrates 2survived 2survived 3survived 4survived 5survived 6survived 7survived 8survived 9survived 10worsens 2smoke 2smoke 3smoke 4smoke 5smoke 6smoke 7smoke 8smoke 9smoke 10cigarette 2cigarette 3cigarette 4cigarette 5cigarette 6cigarette 7cigarette 8cigarette 9cigarette 10month 2month 3month 4month 5month 6month 7month 8month 9month 10rewarding 2
alleviatealtersorchestratesjudesnowballsurvivedsmearspapworsenssmokecigarettemonthyipsspellsrewardingmagnifies