The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "reactive" at medical news

Drug may treat previously incurable brain cancer, say Stanford researchers

...rks in part by releasing damaging molecules called reactive oxygen species, or ROS, that destroy cancer cells. Shoucheng Ning, MD, PhD, a research associate working with Knox, thought the drug would release even higher levels of ROS when coupled with radiation therapy. The team tested this idea in both the la...

JCI Table of Contents, November 14, 2003

...th subjects suffered from obesity, hypoadrenalism, reactive hypoglycemia, and elevated levels of certain prohormones, the clinical presentation of subject B was dominated by small intestine dysfunction manifest as severe refractory neonatal diarrhea. Subsequent examination of subject A also revealed such dysf...

JCI Table of Contents

...microorganisms and kill them via the generation of reactive oxygen species (ROS). However, inappropriate and/o...lecular basis for adhesion-mediated suppression of reactive oxygen species generation by human neutrophils AUTHOR CONTACT: Gary M. Bokoch The Scripps Research...

Air pollution may significantly worsen respiratory allergies in individuals with genetic risk

... act by causing the production of molecules called reactive oxygen radicals (hydrogen peroxide, for example) in the lungs' airways. In response, the immune system pumps out substances that cause allergy symptoms. But compounds called antioxidants can detoxify these particles and temper the body's allergic in...

Using vitamin E and C supplements together may reduce risk of Alzheimer disease

...n against damage caused by free radicals and other reactive oxygen species molecular byproducts of basic cellular metabolism. Neurons are especially sensitive to damage caused by free radicals, which is believed to be partially responsible for the development of AD. Incorporating antioxidants (which help t...

Scientists identify cell defects that limit immune system's impact on late-stage tumors

...ponding to a tumor are believed to be specifically reactive to that tumor antigen, it has been assumed perhaps incorrectly that the T cell defects were in some way related to antigen-specificity and reactivity. "We placed non-activated and non-tumor-specific T cells into tumors and found that they readily b...

Jan/Feb 2004 Annals of Family Medicine tip sheet

...s: 1) Timely care should be proactive rather than reactive to avoid prolonged and unnecessary suffering; 2) Team-oriented health care team members, such as nurses and trained lay persons, should play a major role in supporting family self-care efforts and implementing palliative care; 3) Longitudinal care...

'Neutraceuticals'...coming soon to a dentist near you?

...nolulu, HawaiiThe generation and release of excess reactive oxygen species (ROS) are strongly implicated in the pathogenesis of inflammatory periodontitis. The destructive activities of ROS are neutralized by anti-oxidants, which constitute the body's natural defence against excess ROS release. Anti-oxidant m...

A new hypothesis about Alzheimer's disease

...red how inflammation can lead to the production of reactive oxygen species such as ozone, which can trigger pa...d other inflammatory chemicals to produce abnormal reactive metabolites, which, in turn, modify the folding of normal amyloid beta protein. These modified amylo...

Researchers: Diet a significant factor in reducing risk of three common cancers

...eir antioxidant properties; that is, by inhibiting reactive oxidant species. These free radicals form natural... peroxide into water and oxygen, thus neutralizing reactive oxygen species. Ahn wondered if higher levels of the endogenous antioxidants that course through th...

Enzyme prevents lung damage in premature infants

...HAM, N.C. -- An enzyme that protects the body from reactive chemicals called free radicals is crucial in preve...gen-free radicals. Oxygen-free radicals are highly reactive forms of oxygen that can readily combine with and damage proteins and other molecules in body tissue...

Breakthrough therapies treat Crohn's disease

...eatment groups. Additionally, concentrations of C reactive protein (CRP) decreased significantly compared to placebo on day 42 for the 4mg/kg cohort and on days 28, 42, 56 and 84 for the 10mg/kg cohort. Fontolizumab was well tolerated, without infusion reactions or significant (grade three or four) adverse ...

New imaging technique may help reduce risk of heart attacks, strokes

...um. When oxidized by MPO, the probe becomes highly reactive and polymerizes, concentrating the magnetic signal wherever MPO levels are elevated. The signal, then, pinpoints plaque that is most likely to rupture. Another imaging group is lighting up white blood cells in plaques using iron particles, notes Chen...

Envisat witnesses return of the South Polar ozone hole

... into their constituent parts, which can be highly reactive with ozone. Just because they were banned does not mean these long-lived chemicals have vanished from the air, so scientists expect the annual South Polar ozone hole to continue to appear for many years to come. During the southern hemisphere wint...

Envisat Symposium report day 2: GMES turns science to services

...y for monitoring and forecasting greenhouse gases, reactive gases such as ozone-destroying chlorine and also aerosols. On a global scale these data products will be used to monitor long-range atmospheric transport of air pollutants, while improved regional forecasts will be used by air-quality authorities in...

Exercise prevents Parkinson's symptoms in lab model mimicking human form of the disease

...P. Once in the SN, MPTP is converted into a highly reactive molecule called MPP+, which triggers the production of molecules called free radicals. The free radicals, in turn, damage the brain cells. The key to the protective effect of exercise was the increased production of a protein called glial-derived neu...

Surgical procedure to treat GERD in children found to be ineffective

...ociated medical conditions (e.g., cystic fibrosis, reactive airway disease) and those who had no pre-existing diseases that increased their risk of developing GERD. Moreover, children with associated medical disorders had an increased incidence of lung infections and dumping syndrome. Findings from this sin...

Infection in ELBW infants linked with poor neurodevelopmental, growth outcomes

...harmacologic interventions to reduce the impact of reactive oxygen species on vulnerable oligodendroglial [tissue in the central nervous system] precursors. Ultimately, efforts to reduce the high rates of infection in ELBW infants are the most important interventions," the authors conclude....

An apple a day could protect against brain-cell damage

...ing free radicals and inhibiting the production of reactive substances that could damage normal cells. "The studies show that additional apple consumption not only may help reduce the risk of cancer, as previous studies have shown, but also that an apple a day may supply major bioactive compounds, which may...

Antioxidant supplementation may reduce incidence of cancer in men

...me of the harmful effects caused by free radicals reactive molecules produced by metabolism in the body. It has also been suggested that a low dietary intake of antioxidants increases the incidence of cancer and cardiovascular disease. Serge Hercberg, M.D., Ph.D., of the Institut National de la Sante e...

1 2 3 4

(Date:11/21/2008)...Newswire-USNewswire/ -- New research at West Virg... spitless tobacco product aimed at young adults is...RJ Reynolds, Camel Snus - touted as a socially acc...singly high levels of nicotine. , , "Camel ...products," said Bruce Adkins of the state Division...
(Date:11/21/2008)...swire-USNewswire/ -- U.S. News & World Report ...NCQA) ranked BlueChoice(R) HealthPlan of South Car...ans(TM), published in U.S. News & World Report...l ranking ranks the nation,s best health plans bas...QA accreditation scores. NCQA and U.S. News & ...
(Date:11/21/2008)...swire-FirstCall/ -- Barr Pharmaceuticals, Inc. (NY...overwhelmingly approved the proposals submitted to...Pharmaceuticals Industries Ltd. (Nasdaq: TEVA )....elming support of the transaction by the Barr shar...nd CEO. "We are pleased with the progress that we ...
(Date:11/21/2008)...y diseaseits cause remains a mysteryswept into Ath...citizens, soldiers and refugees of the war then ra...with corpses, social order broke down. Over the ne...ens lost a third of its population. It lost the wa...f the end of the Golden Age of Greece. , The Pl...
Breaking Medicine News(10 mins):Health News:Experts Say New Tobacco Product Targets Young Adults 2Health News:Experts Say New Tobacco Product Targets Young Adults 3Health News:BlueChoice HealthPlan Ranks in Top Third of America's Best Health Plans 2Health News:Barr Shareholders Approve Pending Teva Acquisition 2Health News:Barr Shareholders Approve Pending Teva Acquisition 3Health News:Barr Shareholders Approve Pending Teva Acquisition 4Health News:Study of ancient and modern plagues finds common features 2Health News:Study of ancient and modern plagues finds common features 3Health News:Study of ancient and modern plagues finds common features 4
Other Tagsalleviate 2alleviate 3alleviate 4alters 2alters 3alters 4alters 5alters 6alters 7orchestrates 2survived 2survived 3survived 4survived 5survived 6survived 7survived 8survived 9survived 10worsens 2smoke 2smoke 3smoke 4smoke 5smoke 6smoke 7smoke 8smoke 9smoke 10cigarette 2cigarette 3cigarette 4cigarette 5cigarette 6cigarette 7cigarette 8cigarette 9cigarette 10month 2month 3month 4month 5month 6month 7month 8month 9month 10rewarding 2
alleviatealtersorchestratesjudesnowballsurvivedsmearspapworsenssmokecigarettemonthyipsspellsrewardingmagnifies