Tag: "regenerating" at medical news

Schepens scientists regenerate optic nerve for the first time

...l School. "This is the closest science has come to regenerating so many nerve fibers over a long distance to reach...elves to learning the reasons why CNS tissue stops regenerating and to finding ways to reverse that process, using the optic nerve as their research model. The opti...

Spinal repair pioneer to speak in NY on 20th Jan

...and contains adult stem cells which are capable of regenerating the entire system. The intuitive leap was to transplant cells obtained from this area into the injured spinal cord. What we found was that in laboratory animals the cells have a remarkable capacity to integrate into the damaged roadway, open up the...

Several new techniques show promise for spinal cord repair

...e spinal cord. The researchers observed groups of regenerating nerve fibers crossing the spinal cord injury site ...says Filbin. As a result of Rolipram's success in regenerating spinal cord nerve cells, which was an off-label use at the time of Filbin's study, the company Renov...

Blood-forming stem cells fail to repair heart muscle in Stanford study

...e. "We're all interested in finding ways of regenerating the heart," Balsam said. "I think what this study points out is that it's not easy." ...

Adult stem cell research

...in that the heart has its own adult stem cells for regenerating heart muscle tissue following a coronary event. The research paper published in the September 19, 2003, issue of the journal Cell builds upon a study that appeared weeks ago in the September 2 Proceedings of the National Academy of Sciences. The Ce...

Chemical turns stem cells into neurons say scientists at Scripps Research Institute

...urons in the brain are lost, may be ameliorated by regenerating neurons. Another example is Type 1 diabetes, an autoimmune condition in which pancreatic islet cells are destroyed by the body's immune system. Because stem cells have the power to differentiate into islet cells, stem cell therapy could potentially c...

UNC among 10 U.S. medical centers tapped to study living donor liver transplants

...lore, UNC proposes we study drug metabolism in the regenerating livers of donors and recipients. We are also proposing studies on short- and long-term outcomes for donors following donation surgery for living donor liver transplantation," Shrestha said. UNC began its live donor liver transplant program in October...

New horizons of nerve repair

... that cleaves the growth factor at just the time a regenerating nerve cell would be migrating through the matrix. This cell-activated drug delivery system is also incorporated into a gel and delivered from a nerve guide tube, and it's a great example of a new area known as biologically responsible materials. S...

Study identifies new drug target for preserving brain cells

...tissue. "The macrophage reaction is a good one in regenerating tissues, but in a non-regenerating tissue like the brain, it can be devastating," Levison said. When macrophages release IL-1 and attract more of the scavenger cells to the brain, they become exited and overactive, causing harm to other cells nearby...

Chemists take new approach to fighting resistance

...ld's largest scientific society. The report on the regenerating antibiotic is in the Dec. 22 print edition of the Journal of the American Chemical Society; the self-destructive antibiotic is scheduled for the Jan. 13 print issue of the Journal of Medicinal Chemistry. Both articles were published this month-Dec. 4...

New Chemicals Could Lead To First Bone Growth Pill

...n with agents which decrease boneloss." While bone regenerating pills are probably years away from the market, there isthepossibility that one of the new compounds might have a head start in clinicaltrials. Thenatural product candidate is part of a chemical class called statins, some ofwhich arealready in use fo...

Hunter College Biologist Marie Filbin Identifies Mechanism That Blocks All Inhibitors Of Nerve Regeneration; Breakthrough Reported In Neuron Magazine

...themyelin sheath that prevent the spinal cord from regenerating after injury.Her findings are reported in the January issue of Neuron magazine,published on January 28. Up to now, researchers have been focusing on how to block individual inhibitorsthat prevent axons, the long part of the nerve, to regrow after...

Promising New Drug Uses Antibody Targeted Chemotherapy To Fight Leukemia

...nd vital bonemarrow cells that are responsible for regenerating normal blood cells once theleukemia cells are destroyed. A Phase I study of patients with advanced AML demonstrated early efficacy anddefined the appropriate dosing regimen for Phase II studies. Promising data arenow emerging from the current pivota...

Tiny Pellets Could Deliver Alzheimer's Drugs

...mbedded in rat brains has been "very effective" at regenerating dying cells. Cornell polymer chemist Nadya Belcheva has taken the same idea, but reduced it to the microscopic level by coating individual molecules of NGF with a polymer. These microspheres might one day be injected into the affected areas of the b...

1

(Date:8/23/2014)... The MPWMD Board of Directors voted on Monday, August 18th ... of water for commercial and industrial properties. This was ... Archworks, LLC in Carmel, California. , This is a ... district in the State of California has approved this technology ... this time can now be used as a sole source ...
(Date:8/23/2014)... Professional kitchen employees, prospective chefs and food ... for Food Safety Certification exams thanks to the free ... , Dynamic Path announced the release of its Food ... review questions for culinary industry students and professionals. ... of the ServSafe® Food Safety Certification, National Registry of ...
(Date:8/23/2014)... 2014 Pixel Film Studios, a leader of ... release of ProIntro Vol.3, a customizable title tool for ... tile just by dragging ProIntro Vol.3 in their timeline" says ... a definite time saver and i think our users will ... beautifully designed titles made with Final Cut Pro X users ...
(Date:8/23/2014)... Young adults in Athens, GA who find that they ... the phone and call the new helpline which can offer support ... , Troubled Teen Athens is a wonderful resource for an adolescent ... necessary steps to end substance abuse once and for all. When ... friends or peers when really they should put their faith in ...
(Date:8/23/2014)... Dealing with a drug or alcohol substance abuse ... is a child. Adolescent addiction has been an important issue ... a new helpline is now providing a valuable resource for ... a real addiction recovery center. , The Troubled Teens Atlanta ... the community. By calling (404) 975-2762, parents and their teens ...
Breaking Medicine News(10 mins):Health News:Historical Moment in the Monterey Peninsula, Brings Drought Relief Solution to California, with the Help of EcoloBlue and AWG Technology 2Health News:Food Handler Safety Certification Made Easy with Dynamic Path 2Health News:A new plugin was announced today, ProIntro Vol.3 from Pixel Film Studios for Final Cut Pro X 2Health News:Teenagers in Athens, GA are Locating Addiction Recovery Thanks to New Helpline 2Health News:Atlanta’s New Troubled Teen Helpline Is Making a Difference in the Community 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid