Tag: "represent" at medical news

Protein that predicts tamoxifen resistance is identified

...rugs. Blackwell says that elevated levels of MTA-1 represent one of these cellular changes in tumors that stop responding to tamoxifen. "MTA-1 is just one of the proteins that plays a role in tamoxifen resistance, but it is one important step toward helping us better target our therapies toward each woman's pa...

More doubts over value of defibrillators

...d the commonly used cut-off levels for funding and represent poorer value for money than some alternative strategies....

Freezing technique kills majority of small malignant breast cancers

...n size from 8 millimeters to 18 millimeters. These represent the size of tumors often found on screening mammograms. All tumors were biopsied before cryoablation, and were removed by lumpectomy within 23 days of cryoablation. A multidisciplinary team including Roubidoux, Sabel and other colleagues conducted t...

Elderly men receiving excessive prostate cancer screening, study suggests

...eding 12 months, which on the national level would represent approximately 1.47 million U.S. men. Among screened elderly men, 88.4% reported that their doctor first suggested screening and 66.5% reported having a discussion about the advantages and disadvantages of the test with their doctor before the screeni...

Duke cardiologists offer new view of link between aging, atherosclerosis

... A reduction in the consumption of these cells may represent an important benefit of efficient preventative maneuvers such as diet and exercise, the researchers said. While they have proven the role of stem cells in repairing damaged arteries, they believe the same situation could also hold true for other orga...

New investigational vaccine to prevent hepatitis C tested for first time in humans

...The successful development of such a vaccine would represent a major step in combating this growing health problem. Saint Louis University is the only site in the country conducting this pilot study. "There is currently no licensed vaccine to protect against the hepatitis C virus," said Sharon Frey, M.D., prin...

Study finds subtle brain damage in some HIV patients on drug therapy

...r to effective treatment, or whether these changes represent ongoing injury." The study appears in the November 14 issue of NeuroReport.HIV or human immunodeficiency virus, the pathogen that causes AIDS or acquired immunodeficiency syndrome, can produce neurological abnormalities in any part of the nervous sys...

Tumor size predicts survival in patients with lung cancer

...ng even the smallest of lesions that can, in turn, represent early-stage lung disease." "Although further substaging of early-stage lung tumors may be necessary to accurately assess and treat patients with lung cancer, routine CT [computed tomography] screening for the detection of lung cancer is controversial...

Scientists map maturation of the human brain

...rats caused long-lasting tolerance to alcohol, and represent the first investigations into the long-term brain ..."These new finding are novel and important as they represent the first investigations into the long-term brain effects of chronic binge alcohol exposure during a...

New CDC-funded HIV program at UNC integrates treatment with prevention

... infectious diseases clinic. "This number seems to represent a threshold beyond which no one has been able to move." In 1999, the CDC requested that the Institute of Medicine, a component of the National Academy of Sciences, form the Committee on HIV Prevention Strategies in the United States. Among committee ...

Family's income, education affect depression and obesity in teens

... Journal of Public Health. "Obesity and depression represent critical public health problems for today's youth, because both are highly prevalent chronic diseases that track into adulthood," Goodman says. The researchers used 1994 household income data and parents' educational attainment from the families of 1...

Two million neonatal deaths take place in two developing regions of the world

...oping countries. South Asia and Sub-Saharan Africa represent 40 percent of all neonatal deaths, which are infants who die in their first 28 days of life. The study, "The burden of disease from neonatal mortality: a review of South Asia and Sub-Saharan Africa" is published in the October 2003 issue of BJOG: an ...

Cosmetic surgery satisfaction declines with time, Stanford research finds

...ne in satisfaction between three and 30 months may represent a real reduction in clinical improvement over time." Previous studies suggest that clinical results don't always hold up over time, particularly in areas of the face, such as around the eyes and mouth, where movement and expression may impact the qua...

Will stop-smoking patch help slow memory loss?

...holesterol build-up Mild Cognitive Impairment may represent the early stages of memory loss prior to the diagnosis of Alzheimer's disease," said Paul Newhouse, M.D., professor of psychiatry and director of the Clinical Neuroscience Research Unit at the University of Vermont College of Medicine and research di...

President names eight elite scientists and engineers to receive National Medals of Science

...director Rita Colwell said. "These amazing people represent overall close to four centuries worth of experienc...he Institute of Advanced Study in Princeton, N.J., represent the other New York-area medal recipients. "We now see the daily evidence of the tremendous advanceme...

Evidence that neurons prune only 'twigs' to rewire themselves

...e olfactory bulb -- the collection of neurons that represent the initial processing stage for information from odor sensing receptors in the nose. "The olfactory bulb is one of only two areas of the brain where new neurons are being generated throughout life," said Katz. "Neurons in the olfactory bulb are cons...

Repeated alcohol detoxifications can impair cognitive function

...uture functioning. In other words, these findings represent a clue that some patients who have had multiple withdrawals might be impaired and might have trouble with their work and in their personal lives because of their impaired thinking processes."...

Study suggests common use of investigational breast cancer test

... have been entered in a well-stratified manner and represent a broad spectrum of clinical practices from across North America."...

For those who take painkillers regularly, a heartburn pill a day may keep ulcers away

.... The study was done in this group of patients to represent more accurately the "real world" mix of drugs, medical histories and risk factors seen in millions of patients worldwide, says Scheiman, a professor of internal medicine in the U-M Medical School. All of the participants were taking NSAIDs at least f...

The changing face of severe asthma

...uncontrolled in spite of high doses of medication, represent 5 percent to 10 percent of the estimated 20 million asthma patients in the United States. But they are important in terms of suffering, medical costs and difficulty finding effective treatments. Dr. Spahn and his colleagues examined a variety of demo...

1 2 3 4 5 6 7 8 9 10

(Date:3/5/2015)... (PRWEB) March 05, 2015 Kevin Batsford ... by the grips of drug addiction. The siblings frequented ... their habits, and to seek refuge during the night. ... drugs, without consideration for his outward appearance, hygiene, or ... substances. CNY Central reported on Feb. 23rd ...
(Date:3/5/2015)... 05, 2015 The law firm of ... of the upcoming Crain’s Chicago Business Physicians' Breakfast on ... Breakfast will take place from 7:30 to 9:45 a.m. ... Chicago, IL 60611. The morning’s events will include a ... professionals. , The panel discussion is focused on ...
(Date:3/5/2015)... Wilmington, DE (PRWEB) March 05, 2015 ... and false weight loss promises is alarming, with more ... and products without an actual prescription, making it easy ... scams that simply take their money and endanger their ... simple questions before purchasing prescription online diet pills: , ...
(Date:3/5/2015)... Colorful packaging and marketing promises make it hard ... But all it really takes is reading the ingredient ... March 2015 Harvard Health Letter . , "Go ... of the Department of Nutrition at Harvard-affiliated Brigham and ... the markers of good nutrition. , Whole grains should ...
(Date:3/5/2015)... 2015 Daily Greens™, an organic ... smoothie line, Half Pint that will debut nationwide, ... Greens’™ current offerings, Half Pint is crafted with ... and other ingredients that are sourced locally whenever ... To preserve nutrients and extend shelf life, the ...
Breaking Medicine News(10 mins):Health News:The Homeless’ Unaddressed Drug Addiction Continues to Spiral Out of Control, Harbor Village Detox Stresses Treatment for the Homeless 2Health News:The Homeless’ Unaddressed Drug Addiction Continues to Spiral Out of Control, Harbor Village Detox Stresses Treatment for the Homeless 3Health News:Cook County Law Firm to Sponsor Physicians Breakfast 2Health News:Diet Doc Announces Four Simple Questions that Dieters Must Ask Prior to Purchasing Online Diet Pills 2Health News:Diet Doc Announces Four Simple Questions that Dieters Must Ask Prior to Purchasing Online Diet Pills 3Health News:Tips to Find the Healthiest Breakfast Cereals, From the March 2015 Harvard Health Letter 2Health News:Daily Greens™ Debuts Organic Cold-Pressed Smoothie Line for Kids Exclusively in Whole Foods Markets 2Health News:Daily Greens™ Debuts Organic Cold-Pressed Smoothie Line for Kids Exclusively in Whole Foods Markets 3
Other Tags
behaviorseducationalbakerfungidonekoreacomparingbogsdisablingminorgainingfaminevargervikpharmacologyhershjones