Tag: "resistance" at medical news

Strategy effective against drug resistant tuberculosis

...ntrol and prevent tuberculosis in areas where drug resistance is prevalent. Ma de Lourdes Garcia Garcia (Instituto Nacional de Salud Publica, Mexico) and colleagues analysed data from 436 tuberculosis patients from Southern Mexico treated with DOTS between 1995 and 2000. They found that the incidence of previou...

Hospital acquired infections present major problem for infants in developing countries

...oviders. The authors also found that antimicrobial resistance in newborn nurseries in developing countries has reached alarming levels. They estimate that 70% of pathogens isolated from bloodstream infections in babies in hospital nurseries may not be treatable by the antibiotics ampicillin and gentamicin, whic...

Patient with drug-resistant form of HIV identified

...s the combination of these two features multidrug resistance and rapid clinical course to AIDS. Previous resea... mutate to escape immune attack or to acquire drug resistance with surprising speed. One lesson to be drawn from this case, therefore, is that despite all the adv...

Invasive pneumonia and antibiotic resistance decreased after childhood vaccine introduced

ATLANTA--The problem of increasing antibiotic resistance in cases of Streptococcus pneumoniae, a major caus...ral use in Atlanta by the end of 2000. Antibiotic resistance in pneumonia, after increasing steadily in Atlanta from 4.5 per 100,000 in 1994 to 9.3 per 100,000 i...

Mayo Clinic discovers 'new pathway' against pancreatic cancer

...er, NF Kappa B activity is high -- which can cause resistance to chemotherapy drugs used to treat the disease. This new information suggests a potential means of treating pancreatic cancer by a two-pronged attack of administering the gemcitabine in combination with a drug to block GSK-3 Beta. Nearly all die wi...

How effective are herbal supplements in reducing illnesses in children?

...es have suggested that ivy leaf may improve airway resistance in children with asthma. Cough tablets with dried ivy leaf may be effective in decreasing the symptoms of chronic bronchitis in children. One-third of the children receiving ivy leaf reported freedom from bronchitis symptoms. Valerian is the most w...

Some HIV patients at risk of exhausting treatment options

... low toxicity, which are not associated with cross resistance to existing drugs, are urgently needed for such patients, they conclude....

Both inherited traits and tumor mutations affect response to treatment of leukemia

...oncluded that GSTM1 and TYMS, are likely linked to resistance to specific cancer drugs, and that treatment of ALL might be improved in higher-risk patients if therapies were modified to take these inherited risk factors into account. Other authors of this paper are Cheng Cheng, Wei Liu, Shinji Kishi, John T. S...

LA BioMed medical/research briefs March 2005

... PCOS is a hormone imbalance manifested by insulin resistance that interferes with normal ovulation and fertility. The team's results were published in the February issue of Fertility and Sterility and is the first paper to show the association between PCOS and NAFLD. The research findings are important because...

Study examines three-day antibiotic regimens for treating bladder infection in women

...if the likelihood of trimethoprim-sulfamethoxazole resistance is low. In areas where the likelihood of trimethoprim-sulfamethoxazole resistance is high (greater than 20 percent) or in women who have risk factors for trimethoprim-sulfamethoxazol...

Resistance to chemotherapy

Acquired resistance to chemotherapy is a major obstacle to successful ...ncer Center in New York) shed light on what causes resistance to two recently approved lung cancer drugs. The drugs are so-called kinase inhibitors and inhibit ...

Hormone therapy controversy raises drug safety issues

... actually harm the aging woman, why has there been resistance among many physicians and women to changing beliefs and practice patterns?" the researchers ask. They conclude that the conflicting interests of women, physicians and drug companies played a role in the popularity of HT (at one time it was one of the...

Most episodes of HIV 'blips' not clinically significant in patients receiving HAART

...antly, an ultrasensitive method for detecting drug resistance showed no new resistance mutations before, during, or shortly after blips in the study patients....

Small increases or 'blips' in HIV levels do not signal mutations leading to drug-resistant HIV

...ps," generally do not mean the virus is developing resistance to AIDS drugs and gaining strength in numbers. "...he virus has mutated, or changed form. True drug resistance requires changes in therapy which can be very difficult for the patient, says Siliciano. Different ...

Penn joins major NCI research initiative to advance breast cancer therapies

...nced stages of tumor progression, characterized by resistance to therapeutic agents, metastasis, and tumor recurrence, are responsible for the majority of cancer deaths. However, while tumor progression constitutes a problem of unrivaled clinical importance, the underlying mechanisms are largely unknown. Sheddi...

Over prescribing causing high rates of antibiotic resistance in south and east Europe

...colleagues compared antibiotic use with antibiotic resistance rates in 26 European countries from the beginning ...hat aim to reduce inappropriate antibiotic use and resistance levels. In the article they write that the differences in antibiotic use between countries might be ...

Trial reveals safer and simpler approach to treating children with cystic fibrosis

...out once-daily dosing and its effects on bacterial resistance in patients with cystic fibrosis."...

Physicians call for increased funding for federal infectious disease programs

... according to CDC. The total cost of antimicrobial resistance to U.S. society is nearly $5 billion annually, acc... to the Institute of Medicine (IOM). Although drug resistance is on the rise, very few new antibiotics are being developed. "We must reinvigorate the anti-infecti...

Marijuana use affects blood flow in brain even after abstinence

...lsatility index (PI), which measures the amount of resistance to blood flow. This is thought to be due to narrowing of the blood vessels that occurs when the circulation system's ability to regulate itself is impaired. "The marijuana users had PI values that were somewhat higher than those of people with chroni...

Tiny superconductors withstand stronger magnetic fields

...hat the thinner the wire the higher its electrical resistance is. Because nanoscale superconductors don't repel magnetic fields, they could prove useful in a variety of superconducting applications. By incorporating nanowires as filaments in bigger superconducting wires, for example, more current could be carr...

1 2 3 4 5 6 7 8 9 10

(Date:5/22/2013)... 22, 2013 Cedars-Sinai Heart Institute is honoring ... pioneer in modern mitral heart valve repair, Alain ... Corday, MD, International Prize in Heart Research. The ... recognize physicians and scientists conducting groundbreaking research, or ... medicine. , Carpentier is a leading ...
(Date:5/22/2013)... A new study provides neurobiological evidence for ... in people with insomnia, which may have implications ... , "Insomnia has been consistently identified as a ... Franzen, PhD, an assistant professor of psychiatry at ... in the brain circuitry underlying emotion regulation may ...
(Date:5/22/2013)... May 22, 2013 Digital Advertising Agency, ... behalf of its social media management client, Primal ... year's supply of the all-natural organic deodorant. The contest ... of the rapidly-growing start-up deodorant company based in Tampa, ... contest or sweepstakes on a Facebook page is a ...
(Date:5/22/2013)... (PRWEB) May 22, 2013 DiscountFurnaceFilter.com ... quality merchandise ranging from furnace filters, dehumidifiers, fans, ... is excited to add Stadler Form's product line ... summer product line (fans, aroma diffusers and dehumidifiers) ... Form’s Otto Fan is the perfect combination of ...
(Date:5/22/2013)... York, NY and Troy, NY (PRWEB) May 22, ... Medicine at Mount Sinai and Rensselaer Polytechnic Institute ... educational programs, research, and development of new diagnostic ... alliance was commemorated in a signing ceremony on ... initiative to use their expertise—Rensselaer’s in engineering and ...
Breaking Medicine News(10 mins):Health News:Heart valve repair innovator receives Cedars-Sinai Heart Institute's Corday Prize in Heart Research 2Health News:Study shows that insomnia may cause dysfunction in emotional brain circuitry 2Health News:Social Media Management Firm, 21Digital, Launches National Facebook Sweepstakes for Client, Primal Pit Paste 2Health News:DiscountFurnaceFilter.com Now Offers Stadler Form Products - Providing Solutions to All Your Summer Needs 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 3Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 4Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 5Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 6Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 7
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition