Tag: "reveals" at medical news

A growth factor reverses nerve damage in diabetic animals

St. Louis, Nov. 1, 1999 -- A recent study reveals that long-term nerve damage in rats with diabetes can be reversed by treatment with an insulin-like protein. Because the damage mimics some of what's seen in people with diabetes, the results suggest that the protein could one day be used to prevent ...

Reducing the costs of diabetes in Europe: Preventing complications is the key

...e overall cost of individuals with type 2 diabetes reveals thaturgent action is needed to reduce the devastating long-term complications of thedisease, if costs are to be kept under control. "We are facing a potential crisis," warned Professor Massimo Massi-Benedetti,President of the International Diabetes F...

Decline in awareness and treatment of high blood pressure could pose a serious public health threat

...n and Treatment ofHigh Blood Pressure. This study reveals small, but significant, declines inthese percentages. "This [national data] also suggests that instead of making progress in combatingthe health threat posed by high blood pressure, we may actually be backsliding,"Meissner says. "People aren't as a...

For-profit hospital ownership means higher costs, Dartmouth-VA study finds

...end willaffect our health-care system. "Our study reveals that we have a health-care system that continues to rewardthose who do more. And we can't assume that more is better. We need ahealth-care system that rewards those who do better," Fisher adds. The investigators looked at spending in 1989, 1992 and...

New book explores timely social issues of family relationships & raising of children

...c diagnosis of Gender Identity Disorder (GID), and reveals thetroublesome ways in which it is used to "treat" the behavior of children whoseonly "problem" is that they violate social stereotypes of masculine and femininebehavior. While Feder focuses on children who are needlessly subject topsychiatr...

Unexpected target may unlock the door to fighting sepsis

...munoglobulin, only 5 percent survived. "This study reveals that in experimental sepsis, the system that producesprotective mediators is overstimulated, leading to profoundly harmfulconsequences," says Ward. "If this is also the case in humans with sepsis, therecould be obvious implications for a new therapeu...

UMass researchers teaching computers to interpret MRIs

...though the MRI captures a "slice" of the brain and reveals lesions, it'simportant to remember that both the brain and any lesions are actuallythree-dimensional objects, Horowitz noted. Mathematics is integral to computerimaging for several reasons, according to Horowitz. First, in order to give acomputer ins...

Noninvasive test aims to prevent sudden cardiac death

...e characteristic response to changes in heart rate reveals a patient's susceptibility to arrhythmias. The results also suggest several ways to further improve the accuracy of the test. When Smith was a graduate student at the Massachusetts Institute of Technology, he read that sudden cardiac death was the m...

Controversy Over The Effects Of Passive Smoking

...nto two camps. Onone side are those who believe it reveals the existence of a highly non-lineareffect of tobacco smoke on the body, where just a whiff can trigger a dramaticincrease in risk. On the other side are those who, like Bailar, suspect the discrepancyhighlights fundamental flaws in the meth...

Possible Mechanism For Estrogen Memory Enhancement Found

...ysiologist Richard F.Thompson, Ph.D. "Our research reveals a chemical mechanism that could explainhow the delay in onset occurs." Dr. Thompson and his colleagues measured the excitability and long-termpotentiation between neurons from the brain of a rat, both before and afterexposing slices of the brain's hi...

New Book (And Web Site) Use 'Currency' Of Aging To Guide And Motivate Healthy Choices

...places a value on those choices just as a pricetag reveals the value of a product." The idea actually came from a patient, an investment banker with highblood pressure who wasn't taking his medications. Why, Roizen wondered,would the beneficiary of a lifetime of delayed gratification, a bright,wealthy, highl...

Wine Drinkers Consume Heart-Smart Diets

...he American Journal of ClinicalNutrition, however, reveals that people who drink wine tend to choose foods that are healthier for the heart. Lead author of the study, Dr. Anne Tjonneland from the Danish Cancer Society, Institute of CancerEpidemiology, says "The important message in our study is that there i...

How HIV Evades AZT

... picture of a key AIDS virus enzyme. The structure reveals details that clarify how HIV mutations render the retrovirus resistant to antiviral drugs such as AZT. Once HIV invades a human cell, reverse transcriptase (RT), one of three enzymes used by HIV, reads the retrovirus's genetic material, RNA, and syn...

Tobacco Will Kill One Third Of Chinese Men

...ated diseases in middle or old age. The study also reveals that the pattern of disease caused by smoking varies widely both within China and between China and the developed world. Of deaths caused by tobacco in China, 45 per cent are from chronic lung disease, 15 per cent from lung cancer and five to eight ...

Crystal Structure Of gp120 Reveals HIV In Action

...ons of the molecules that the new crystalstructure reveals to be crucial to infection. The crystal structure also reveals potential new drug targets. "At theinterface of the gp120/CD4 receptor is a large cavity that is a ...

Baby Milk Manufacturers Are Breaking The Rules

...the Interagency Group on Breastfeeding Monitoring, reveals that baby milk manufacturers are breaking the international code of marketing breast milk substitutes, which was adopted by the World Health Assembly in 1981. The code was introduced to encourage mothers to breast feed their babies, in an attempt t...

A Good Night's Sleep Is Possible At High Altitudes

...upplied to the heart. In this week's BMJ Dubowitz reveals the results of a study of the effects of altitude on eleven people at the base camp of Mount Everest. The author found that 10mg of a short acting benzodiazepine (in this case the sedative temazepam') improved the quality of sleep and reduced the c...

Fertilization Protein Structure To AID in Leukemia Treatment

...mensional image has been reconstructed. The image reveals that two of the molecules combine together to create a hole, or molecular cavity, between the proteins. Inside this cavity the protein traps the DNA building blocks and rearranges their pattern of chemical bonds to synthesize the messenger. ...

1 2 3 4 5 6 7 8 9

(Date:6/19/2013)... MinuteHound, a leading time and attendance technology ... up to 8% on payroll costs. MinuteHound’s system eliminates ... systems. Their biometric system is simple: Employees place their ... in and out automatically. Employee time clocks ... punching. , Because the fingerprint data is encrypted ...
(Date:6/19/2013)... Faith4Kidz is starting a new fundraising effrt to support ... help showing support for kids to learn how to independently ... out the website, http://www.gracenfaith.com to see Faith4Kidz logo ... and blue stars as a symbol of our country and ... as the stars we should encourage our children to reach ...
(Date:6/18/2013)... 2013 As a sponsor of the 2013 Fourth of ... at Lake Meridian Chiropractic want you to get out and celebrate! ... the event and are excited to be involved. “My husband and ... always loved going to the Kent Splash event. It's a tradition ... sense to financially support this fun day.” , The ...
(Date:6/18/2013)... York (PRWEB) June 19, 2013 Parker ... the rights of victims injured by dangerous drugs and ... an Arizona woman who alleges that she was ... filed on May 30th in the U.S. District Court ... No. 2:13-cv-12677) in the multidistrict litigation entitled In Re: ...
(Date:6/18/2013)... Daily Gossip Magazine has always kept its readers entertained ... , The magazine has decided to prepare readers for the ... recipe every week . , According to Daily Gossip ... readers who are looking to get insights into this type ... anabolic food is almost entirely based on healthy, yet tasteful ...
Breaking Medicine News(10 mins):Health News:MinuteHound Announces How Cloud Computing Technology Boosts Savings 2Health News:MinuteHound Announces How Cloud Computing Technology Boosts Savings 3Health News:Faith4Kidz Introduces Patriotic Hats to Benefit the "Grace in Faith Equals Peace" Mission 2Health News:Lake Meridian Chiropractic of Kent, WA to Sponsor the Fireworks Finale at 15th Annual Fourth of July Splash 2Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 2Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 3Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 4Health News:Anabolic Cooking Book Review Exposes Dave Ruel’s Top 10 ‘Anabolicious’ Recipes for BodyBuilders 2
Other Tags
primitivespecificdamagehavewilsonlocalizedantibacterialgalliumstandlegalflawedfatallysimilarpeersattractattitudes