Tag: "reversible" at medical news

Study shows use of budesonide reduced the risk of asthma related events by 40% in children

... asthma at some point in their lives. Asthma is a reversible obstructive lung disease, caused by increased reaction of the airways to various stimuli, such as cigarette smoke, airborne molds, pollens, dust, animal dander, exercise, cold air, many household and industrial products, air pollutants, scents or sim...

UIC offers new weight loss surgery for obese teens

...ally invasive procedure is the only adjustable and reversible surgical weight-loss option available in the United States. UIC is the only medical center in the United States currently involved in a Food and Drug Administration-approved protocol to study the safety and effectiveness of the LAP-BAND system in pat...

Johns Hopkins scientists receive presidential medals

...ered the labeling of receptors by a process called reversible ligand binding, which led to his and colleagues' discovery of the opiate receptor, and he extended the technique to identify numerous other neurotransmitter receptors in the brain. In characterizing each new group of receptors, he also clarified the...

'Broken heart' syndrome: Real, potentially deadly but recovery quick

...den emotional stress can also result in severe but reversible heart muscle weakness that mimics a classic heart attack. Patients with this condition, called stress cardiomyopathy but known colloquially as "broken heart" syndrome, are often misdiagnosed with a massive heart attack when, indeed, they have suffer...

Bone density appears to recover after adolescents discontinue injected contraceptive

...d and that bone density loss may not be completely reversible after discontinuation of the drug. The FDA warning states: "Depo-Provera Contraceptive Injection should be used as a long-term birth control method (e.g. longer than 2 years) only if other birth control methods are inadequate." The black box warning...

Nerve damage from alcoholism reversed after liver transplantation

...europathy in a patient with alcoholic cirrhosis is reversible and should not constitute a contraindication to OLT, even when the neuropathy is disabling." ...

New study shows patients experience asthma variability, despite strict adherence to guidelines

...ma atsome point in their lives.(2) Asthma is a reversible obstructive lung disease, caused by increasedreaction of the airways to various stimuli, such as cigarette smoke, airbornemolds, pollens, dust, animal dander, exercise, cold air, many household andindustrial products, air pollutants, scents or simple...

Novel drug-antidote strategy provides greater control of drug action

...dote pair, physicians will have a more predictably reversible anticoagulant that is easier to use and will require significantly less monitoring," Rusconi continued. Rusconi recently left Duke to co-found Regado Biosciences, Inc. with Sullenger. Regado is based in Research Triangle Park, N.C. and h...

New data show SPIRIVA significantly reduces COPD exacerbations and related health resource burden

...ng. SPIRIVA works through targeting of a dominant reversible mechanism of COPD cholinergic bronchoconstriction. SPIRIVA helps COPD patients breathe more easily by opening narrowed airways and helping to keep them open for 24 hours. According to treatment guidelines of the Global Initiative for Chronic Obstruc...

Researchers induce temporary blindness to learn more about vision

...plied to the visual cortex, TMS induces temporary, reversible blindness lasting only a fraction of a second. TMS was administered on 75 percent of the trials at optimal times to produce visual suppression. Participants were asked to report verbally after each trial whether they had perceived the dis...

A non-invasive treatment for angina does not lead to enhanced athletic performance

...device has been shown to decrease exercise induced reversible perfusion (blood flow) defects, improve diastolic filling, left ventricular end-diastolic pressure, and left ventricular peak filling rate and end-diastolic volume, and time to peak filling rate. Additionally, experience with EECP suggests a possibl...

Optical glucose sensor holds promise for diabetics and intensive care patients

...s glucose under physiological conditions, giving a reversible fluorescent signal that changes intensity in respo..., Singaram said. "This is the first system to show reversible optical sensing of glucose with a thin-film hydrogel. We tested the sensor under conditions that are...

St. Jude Medical announces CRT patients showed improvement in the RHYTHM ICD study

...anced heart failure (NYHA Class III/IV) not due to reversible causes, for at least six months, despite receiving optimal pharmacological therapy for a minimum of 90 days; an ejection fraction of = 35% (volume of blood pumped compared to volume filled), and a prolonged QRS duration (ventricular activity shown in...

Study finds no causal link between testosterone replacement, prostate cancer or cardiac disease

...ely of clinical significance (fluid retention); or reversible with cessation of treatment (gynecomastia, testicular atrophy or infertility). Testosterone treatment should be used cautiously or not at all in men with advanced liver disease. Skin reactions are commonly encountered in men being treated with the pa...

Bone marrow cells improve failing heart function

...nd six months. In the treatment group, the total reversible defect made up about 15 percent of the tissue at b...hs and 8.8 percent at six months. Among controls, reversible defects increased from an average 10 percent at baseline to 32 percent at two and six months. "Ther...

Stroke treatment may come from physiological determinations not time frame, says Pitt

...termination of both irreversible ischemic core and reversible penumbra in acute stroke. The study was led by Tudor Jovin, M.D., assistant professor of neurology at the University of Pittsburgh School of Medicine and a member of the University of Pittsburgh Medical Center Stroke Institute. Researchers used xenon...

New drug for non-small cell lung cancer shows efficacy

...s receiving the500 mg doses. All side effects were reversible when drug use was stopped. The Food and Drug Administration approved the 250mg. dose of gefinitib for treatment of advanced non-small cell lung cancer. "For patients with metastatic lung cancer who have no other options,lessening their symptoms witho...

Lens replacement material holds prospect of 'young' eyes for people over 40

...al ways. One significant difference, she says, is reversible disulfide bonds. "This means that after forming t...e material the research group is using to form the reversible bonds acrylamide is a known neurotoxin, but Fetsch doesn't think that will be a problem because th...

Other highlights in the September 3 issue of JNCI

...Montreal. Cervical cancer results from a series of reversible changes in the cervical tissue. A biomarker that could predict the duration of a cervical lesion or the speed of its progression or regression would be useful for identifying women whose lesions are likely to progress quickly to more advanced stages....

United States to host World Sight Day celebration October 10

...long been committed to eradicating preventable and reversible blindness around the world, we are focusing increased attention on working with our partners to prevent blindness and vision loss in the United States." Lions Clubs International is marking World Sight Day by launching a major initiative to combat vi...

1 2 3

(Date:11/22/2014)... 23, 2014 BambooFlooringChina.com is a ... has proudly released its new collection of bamboo mats ... up to 29% off. , According to the ... tree-like grass, making it a highly renewable resource. Their bamboo ... a mixing color which comes from natural bamboo with caramel ...
(Date:11/22/2014)... Setria® Glutathione is now available ... for use “as a therapeutically active ingredient in ... Therapeutic Goods (Listing) Notice 2014 (No. 5) - ... Glutathione will be exclusivity distributed in Australia by ... imports fine chemicals to Australian manufacturers. TGA approval ...
(Date:11/22/2014)... (PRWEB) November 22, 2014 Discount-Dress.com ... aim of the firm is to increase the company’s online ... introduced a new selection of bridesmaid dresses and announced a ... offer is valid until Dec. 30, 2014. All the dresses ... also inexpensive. , In fact, Discount-Dress.com is very good ...
(Date:11/22/2014)... Nocturia is defined by the International ... individual has to wake at night one or ... Pipeline Review, H2 2014” provides comprehensive information on ... analysis at various stages, therapeutics assessment by drug ... (RoA) and molecule type, along with latest updates, ...
(Date:11/22/2014)... A petition seeking a ban on ... in minimally-invasive hysterectomies and fibroid removal surgeries has gained ... October, Bernstein Liebhard LLP reports. According to Change.org, ... 21st, 2014. That represents an increase of 456 signatures ... to the campaign.* , The campaign to ban uterine ...
Breaking Medicine News(10 mins):Health News:Trendy Bamboo Mats Online Now By BambooFlooringChina.com 2Health News:Setria® Glutathione Now Available in Australia 2Health News:Setria® Glutathione Now Available in Australia 3Health News:Bridesmaid Dresses Introduced by Famous Company Discount-Dress.com For The New Year 2015 2Health News:Nocturia Therapeutic Pipeline Market Review by Drugs and Companies H2 2014 Report at RnRMarketResearch.com 2Health News:Nocturia Therapeutic Pipeline Market Review by Drugs and Companies H2 2014 Report at RnRMarketResearch.com 3Health News:Nocturia Therapeutic Pipeline Market Review by Drugs and Companies H2 2014 Report at RnRMarketResearch.com 4Health News:Power Morcellator Petition Gains More than 450 Signatures Since October, Bernstein Liebhard LLP Reports 2Health News:Power Morcellator Petition Gains More than 450 Signatures Since October, Bernstein Liebhard LLP Reports 3Health News:Power Morcellator Petition Gains More than 450 Signatures Since October, Bernstein Liebhard LLP Reports 4
Other Tags
bloomduecorpsesmellyvalvesimplifyarisingschrenkinsurancecirrhosiscelecoxibtooculpritfindresearchersstanford