The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "safety" at medical news

First head-to-head study to compare lidoderm patch and Celebrex in treating pain

...g daily functioning and quality of life. Due to safety concerns regarding the entire COX-II inhibitor cla...ither one or both knees and evaluated efficacy and safety of treatment. After a 7- to 14-day wash-out period during which all analgesic medications, chondroi...

Study shows patch therapy may be as effective as oral medications

...orosis Center, and study author. "With medication safety being on the minds of many people, it's promising ...ts in the Celebrex group. However, due to recent safety concerns regarding the entire COX-2 inhibitor class, the sponsor of the study, Endo Pharmaceuticals ...

Unexpected benefit seen in treating HER-2 breast cancer with new preoperative drug combo

...treatment, "the jury is still out on the long-term safety and outcome. As in all such studies, we will need to wait years to follow the progress of our patient participants," Buzdar says. Details of the trial result, slated for the June issue of the journal, were posted online Feb. 28 because of interest in...

OHSU scientists test medication to treat involuntary weight loss

...e related oral medications to determine the drug's safety and effectiveness. "We believe the results obtained in this collaborative study with OHSU will provide an important proof-of-principle for Neurocrine's small molecule MC4 receptor antagonist program in animal models relevant for cachexia," said ...

Professionalism and professional ethics in medicine

...medicines. "Further work is needed to evaluate the safety and effectiveness of these strategies," the authors conclude. (Arch Intern Med. 2005; 165: 633 636. Available post-embargo at www.archinternmed.com .) Physicians' Response to Scarcity To contact Samia A. Hurst, M.D., e-mail samia.hurst@medecine.u...

Hepatotoxicity and statins

...hrough statin therapy. "The studies examining the safety of statins in patients with NAFLD are limited, but the existing data provide some evidence that they can be used safely," reports the author, whose own studies recently showed that hyperlipidemic patients with elevated baseline liver enzymes are not ...

Hopkins begins human trials with donor adult stem cells to repair muscle damaged from heart attack

...he so-called Phase I study is designed to test the safety of injecting adult stem cells at varying doses in patients who have recently suffered a heart attack. An estimated 7 million Americans alive today have suffered at least one heart attack and so are at greater risk for chronic heart failure, sudde...

Billions in cost estimated for firefighter injuries

...rity included expenditures for insurance coverage, safety training, physical fitness programs and protective...ndary and real," but calls for new ways to instill safety awareness in firefighters. It also says that training injuries can be minimized by developing better...

Vaccine against childhood pneumonia shows promise

...hild mortality by 16%. The vaccine also had a good safety profile. Professor Cutts comments: "The trial results are highly promising, and provide us with a clearer picture of the pneumococcal disease burden in Africa. In the control group, 65% of invasive disease episodes were of serotypes contained in the...

NIH state-of-the-science panel calls for 'demedicalization' of menopause

...es that are known to carry serious risks, or whose safety is as yet unclear. However, many women, particula...een very few well-designed studies to evaluate the safety and effectiveness of complementary and alternative approaches to menopausal symptom management, incl...

Massive weight loss conference Dallas April 1-2

...atment options, expectation management and patient safety considerations for this patient population. In the United States, obesity has risen at an epidemic rate during the past 20 years, according to the Centers for Disease Control. Results of the National Health and Nutrition Examination Survey (NHANES) 1...

Yale technology translates to sonic golf training tool

...motiondetecting sensors, similar to those used for safety airbag deployment in cars, embedded in the shaft. Sonic Golf's unique feature is the use of realtime audio feedback. "We were able to identify a signal from the sensors related to the speed of the club," Grober said. "We convert this signal into an a...

NIAID initiates trial of experimental avian flu vaccine

...cruitment has begun for a trial to investigate the safety of a vaccine against H5N1 avian influenza, the Nat...y 2004. This Phase I trial will test the vaccine's safety and ability to generate an immune response in 450 healthy adults aged 18 to 64. If the vaccine is sh...

Study shows use of budesonide reduced the risk of asthma related events by 40% in children

...en's Hospital in Boston and an investigator in the safety and tolerability portion of the study. "The findings of these two analyses showed that budesonide had a viable long-term treatment effect." In the first analysis, 1,974 children were randomized to receive either once-daily budesonide or placebo in ...

Liverpool to lead 20M Department of Health initiative to develop medicines for children

...k to undertake important clinical studies into the safety and effectiveness of medicines for children. The University will become the Co-ordinating Centre for this new network, to be based at the Institute of Child Health at Alder Hey site. The UK Medicines For Children Research Network will enable the dev...

Most hospital executives have substantial concerns about mandatory error reporting systems

...ntial system would discourage reporting of patient safety incidents to their hospital's own internal reporti...e having no effect or a negative effect on patient safety (73 percent). More than 80 percent felt that the names of both the hospital and the involved profess...

New ways to design safer & more effective topical (transdermal) drug delivery announced in the PNAS

... the molecular forces that are associated with CPE safety and potency. They then screened the new CPEs, firs...and our ability to evaluate potential new CPEs for safety and efficacy," said Mitragotri. "By enhancing our ability to deliver drugs topically, we will be ab...

GlaxoSmithKline receives unanimous favorable recommendation by FDA Advisory Committee for Boostrix

...ee reviewed several clinical trials which included safety and immunogenicity data from one pivotal trial, wh...nus and Diphtheria Toxoids] with regard to overall safety and immunogenicity. In addition, the use of Boostrix induced anti-pertussis antibody levels, which ...

Rasagiline reduces disability for patients with advanced Parkinson's disease

...pone) when compared with placebo. Rasagiline had a safety profile similar to that of the placebo and its once daily regimen was convenient to administer. The drug was well tolerated in the old-age group (d70). Professor Rascol states: "This study has shown that rasagiline is an effective, safe and simple tr...

Drug that hinders blood vessel growth under study in ovarian cancer

...on for these women. The current study explores the safety and efficacy of two different doses of the drug compared to placebo. Study participants must be in clinical remission and have a history of normal CA 125 levels that have begun to rise but still have no evidence of cancer on physical exam or computer...

1 2 3 4 5 6 7 8 9 10

(Date:11/21/2008)...Newswire-USNewswire/ -- New research at West Virg... spitless tobacco product aimed at young adults is...RJ Reynolds, Camel Snus - touted as a socially acc...singly high levels of nicotine. , , "Camel ...products," said Bruce Adkins of the state Division...
(Date:11/21/2008)...swire-USNewswire/ -- U.S. News & World Report ...NCQA) ranked BlueChoice(R) HealthPlan of South Car...ans(TM), published in U.S. News & World Report...l ranking ranks the nation,s best health plans bas...QA accreditation scores. NCQA and U.S. News & ...
(Date:11/21/2008)...swire-FirstCall/ -- Barr Pharmaceuticals, Inc. (NY...overwhelmingly approved the proposals submitted to...Pharmaceuticals Industries Ltd. (Nasdaq: TEVA )....elming support of the transaction by the Barr shar...nd CEO. "We are pleased with the progress that we ...
(Date:11/21/2008)...y diseaseits cause remains a mysteryswept into Ath...citizens, soldiers and refugees of the war then ra...with corpses, social order broke down. Over the ne...ens lost a third of its population. It lost the wa...f the end of the Golden Age of Greece. , The Pl...
Breaking Medicine News(10 mins):Health News:Experts Say New Tobacco Product Targets Young Adults 2Health News:Experts Say New Tobacco Product Targets Young Adults 3Health News:BlueChoice HealthPlan Ranks in Top Third of America's Best Health Plans 2Health News:Barr Shareholders Approve Pending Teva Acquisition 2Health News:Barr Shareholders Approve Pending Teva Acquisition 3Health News:Barr Shareholders Approve Pending Teva Acquisition 4Health News:Study of ancient and modern plagues finds common features 2Health News:Study of ancient and modern plagues finds common features 3Health News:Study of ancient and modern plagues finds common features 4
Other Tagsalleviate 2alleviate 3alleviate 4alters 2alters 3alters 4alters 5alters 6alters 7orchestrates 2survived 2survived 3survived 4survived 5survived 6survived 7survived 8survived 9survived 10worsens 2smoke 2smoke 3smoke 4smoke 5smoke 6smoke 7smoke 8smoke 9smoke 10cigarette 2cigarette 3cigarette 4cigarette 5cigarette 6cigarette 7cigarette 8cigarette 9cigarette 10month 2month 3month 4month 5month 6month 7month 8month 9month 10rewarding 2
alleviatealtersorchestratesjudesnowballsurvivedsmearspapworsenssmokecigarettemonthyipsspellsrewardingmagnifies