Tag: "screened" at medical news

Noni plant may yield new drugs to fight tuberculosis

...Manila, Philippines. The researchers randomly screened a group of native plants for potential activity against Mycobacterium tuberculosis, the bacterium that causes TB. In laboratory tests, a concentration of extracts from the leaves of the noni showed a significant inhibitory rate, killing 89 percent of...

Researchers build on discovery of potent potential antibiotic

...hemical Society. In that project, the researchers screened some 150,000 compounds and found one, PD 404182, that was 10,000 times more effective than other known inhibitors of a key enzyme in Gram negative bacteria. The compound targets the enzyme KDO 8-P synthase, which plays a vital role in the formation ...

Breast cancer risk lower than women think; statistics by age, ethnicity give more realistic picture

...s. Most guidelines call for women to start getting screened regularly at about age 50, a recommendation the authors dont question. In comparison, the average 40-year-old woman has a 1-in-189 risk of developing breast cancer in that time period and a 1-in-26 risk within 20 years. A 60-year-old woman still ha...

Training for doctors improves screening for risk-taking in teens

...cal exams can increase the number of teens who are screened for several risky behaviors by an average of 16 pe...ipating in the study, three-quarters of teens were screened for some types of risk. "Most teenagers are healthy," said UCSF assistant research psychologist Juli...

Nutritional screening may predict risk for hospitalization of elderly

...ed in a Medicare managed-risk health plan and were screened at numerous clinic sites as part of a health plan enrollment packet. The Probability of Repeated Admission (PRA) is a screening instrument specifically developed to identify older persons most likely to be hospitalized. The Level II Nutrition Screen...

COOL AID safe after stroke, may deter side effect of clot-busters

...who arrived within six hours of symptom onset were screened for the study. Hypothermia was initiated with cooling blankets and ice water/alcohol baths. To prevent shivering, the patients received drugs to paralyze them, were sedated, and had breathing tubes inserted. It took an average of three and half...

Detecting Alzheimer's

...rial participants have in common with people being screened for Alzheimers disease or other ailments affecting the brain such as strokes? The answer is NeuroGraph, a portable device that provides an almost instantaneous reading of brain activity and can swiftly detect differences from the norm. Developed with...

Doctor, counselor, cost-cutter

...tablish at-risk alcohol behaviors. Of the 774 who screened positive, 382 were assigned to a control group and 392 received an intervention program called Project TrEAT (Trial for Early Alcohol Treatment), a protocol originally developed in England that was modified by Fleming and his co-authors. Project TrEA...

Testing for alcohol problems in the workplace

...sed primarily for comparison purposes. Researchers screened 989 (676 males, 313 females) voluntary participants with AUDIT, CDT and GGT measures during 36 months at a large Swedish workplace. The study population comprised approximately 15% of the total workplace population. Test results were compared with ...

Gene discovery shows heart failure cause, suggests treatments and screening potential

...e laboratory. "Relatives of this patient also were screened for the disease. Although none of them had heart failure symptoms, echocardiograms revealed that an aunt had dilated cardiomyopathy and a daughter had a slightly enlarged main pumping chamber. With clinical testing of patients relatives, we could ide...

Depression raises heart failure rate in elderly women

... of Emory University School of Medicine. Women who screened positive for depression at the beginning of the study were nearly twice as likely to develop heart failure during the 14 years of follow up, according the results published in the January issue of Psychosomatic Medicine. Heart failure occurs when ine...

Should women be screened for domestic violence?

...esearchers in this week's BMJ ask: Should women be screened for domestic violence when they visit their general practitioner?Is there a high risk group of women for whom screening might be more appropriate?Is screening acceptable to women? A sample of women visiting 13 general practices in Hackney, east Londo...

Dartmouth research examines the value of cancer screening

...at risk for certain cancers when they decide to be screened for them. "They should be asking their physicians ...ky-diagnosis bias, deaths from other causes in the screened group are falsely attributed to cancer because that cancer was detected by screening. This type of m...

Misclassification of death may influence perceived value of cancer screening

... one form of bias, deaths from other causes in the screened group are falsely attributed to the target cancer because the cancer was detected by screening. This form of misclassification, called sticky-diagnosis bias, biases the disease-specific mortality results against screening. In the second form of bias...

Women more likely to get regular cancer screening if primary care is well-organized, study finds

...tality significantly. Women were more likely to be screened for cancer if they saw specific primary care clinicians on a regular basis, the study found. Although progress has been made in narrowing the gap in screening rates between minority and non-minority populations, barriers to screening persist even amo...

Police officers who experience panic during traumatic event have greatest risk of PTSD

...very traumatic incident, police officers should be screened for their immediate emotional reactions. Those who report feeling intense fear, horror, or helplessness, or those who have a profound sense that the event was unreal, should be targeted for education, supportive counseling and, if symptoms persist, ...

New medical system for colon cancer screening

...od and the reluctance of the general public to get screened play a major role in colorectal cancer being the second leading cause of cancer related death in America. Virtual Colonoscopy is a breakthrough alternative procedure which can identify colon polyps before cancer spreads, is patient friendly, and can ...

Annals of Internal Medicine, tip sheet, February 19, 2002

...an estimated 45 percent of blood donations are not screened for HIV and hepatitis C or B viruses. According to the authors, implementing policies to protect the blood supply may shrink available resources in developing countries and take away from other gains in health. Review: Identifying and Treating the ...

American Thoracic Society Journal news tips for February (second issue)

...ECTS LUNG CANCER AT EARLIEST STAGE In a study that screened 1,520 individuals age 50 and over at high risk for...n studies from other countries. The investigators screened 1,977 admissions to the units between October 1 and November 30, 1999. (Lung injury from pneumonia ...

Mayo Clinic study defines patients at greater risk for developing multiple myeloma and related bone marrow cancers

...inic hematologists do not recommend that people be screened for the M-protein. Instead they suggest that physicians monitor patients diagnosed with MGUS through annual blood testing for the lifetime of the patient involved....

1 2 3 4 5 6 7 8 9 10

(Date:8/23/2014)... The MPWMD Board of Directors voted on Monday, August 18th ... of water for commercial and industrial properties. This was ... Archworks, LLC in Carmel, California. , This is a ... district in the State of California has approved this technology ... this time can now be used as a sole source ...
(Date:8/23/2014)... Professional kitchen employees, prospective chefs and food ... for Food Safety Certification exams thanks to the free ... , Dynamic Path announced the release of its Food ... review questions for culinary industry students and professionals. ... of the ServSafe® Food Safety Certification, National Registry of ...
(Date:8/23/2014)... 2014 Pixel Film Studios, a leader of ... release of ProIntro Vol.3, a customizable title tool for ... tile just by dragging ProIntro Vol.3 in their timeline" says ... a definite time saver and i think our users will ... beautifully designed titles made with Final Cut Pro X users ...
(Date:8/23/2014)... Young adults in Athens, GA who find that they ... the phone and call the new helpline which can offer support ... , Troubled Teen Athens is a wonderful resource for an adolescent ... necessary steps to end substance abuse once and for all. When ... friends or peers when really they should put their faith in ...
(Date:8/23/2014)... Dealing with a drug or alcohol substance abuse ... is a child. Adolescent addiction has been an important issue ... a new helpline is now providing a valuable resource for ... a real addiction recovery center. , The Troubled Teens Atlanta ... the community. By calling (404) 975-2762, parents and their teens ...
Breaking Medicine News(10 mins):Health News:Historical Moment in the Monterey Peninsula, Brings Drought Relief Solution to California, with the Help of EcoloBlue and AWG Technology 2Health News:Food Handler Safety Certification Made Easy with Dynamic Path 2Health News:A new plugin was announced today, ProIntro Vol.3 from Pixel Film Studios for Final Cut Pro X 2Health News:Teenagers in Athens, GA are Locating Addiction Recovery Thanks to New Helpline 2Health News:Atlanta’s New Troubled Teen Helpline Is Making a Difference in the Community 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid