Tag: "selenium" at medical news

First Evidence Found Of Link Between Gum Disease And High Alcohol Consumption, Low Dietary Antioxidants

...mpared with antioxidantstatus. Results showed that selenium has the strongest association with gumdisease, with low levels increasing the risk by 13 fold. Low levels of vitaminsA and C, a-carotene and b-crytoxanthin also increased significantly the risk ofgum disease. The only antioxidant studied in which l...

Toward a better burger: "Where's the selenium?"

...direct connection exists between concentrations of selenium in the soil and in beef. Specifically, the USDA sc... to know whether beef from areas with soil high in selenium accumulates high concentrations of the mineral. It does, they learned, and according to lead resea...

Wake Forest University Baptist Medical Center participates In largest-ever prostate cancer prevention trial

... prostate cancer prevention study, to determine if selenium and vitamin E prevent prostate cancer. Launched...University. "Previous research with vitamin E and selenium - in studies focused on other types of cancer - suggested that these nutrients might prevent prostat...

Rush receives grant from IDPH to focus on prostate screening for African-American men

...pitals kicked off a clinical trial to determine if selenium and Vitamin E prevent prostate cancer. Rush recently enrolled its 100th man in that trial, called the SELECT trial, and is the fourth most active site among the 356 sites in the country enrolling African Americans. To participate in Project COOPE...

Diet rich in foods with Vitamin E may reduce Alzheimers disease risk

...LECT), this investigation is testing vitamin E and selenium in healthy men age 60 and older for preventing cognitive decline and AD. (Some study sites have begun recruitment and others will begin enrolling participants over the next few months. See below on obtaining more information from NIA's ADEAR Center.)...

Other highlights of the May 21 JNCI

... in People with Barrett's Esophagus: Higher serum selenium levels appear to be associated with a reduced risk...nd found that people with higher concentrations of selenium in their blood were less likely to have increased 4N fraction, aneuploidy, and high-grade dysplasia-...

The nature of the healing process using alternative means to conventional medical care

...t nutrients such as vitamins C, E, beta carotenes, selenium and zinc. Defeating the Lethal Skin Cancer Melanoma Differently Melanoma is the most deadly form of skin cancer and is increasing in increasing in incidence faster than any other form of cancer. Naturopathic medicine can impact the growth and spr...

Other highlights in the October 1 issue of JNCI

...ere randomly assigned to receive 200 micrograms of selenium per day or aplacebo. At the end of the study, there was no association between seleniumsupplementation and risk of basal cell carcinoma. However, seleniumsupplementation was associated with an increased risk of squamous cellcarcinoma and of total non...

Major prostate-cancer prevention study to launch awareness campaign in churches nationwide

... determine whether vitamin E and the trace element selenium can protect against prostate cancer, the most common form of malignancy in men after non-melanoma skin cancer. "Since study recruitment began in the summer of 2001, we have enrolled 27,067 men and have met more than half of our recruitment goal, but ...

M. D. Anderson, African-American churches team up for prostate cancer prevention study

... research group), is designed to determine whether selenium and vitamin E, or both, can prevent prostate cancer, the third leading cancer killer in men. Increasing enrollment of African-American men is important because they are more likely to be diagnosed with prostate cancer and are twice as likely to die ...

American Thoracic Society Journal news tips for February 2004 (first issue)

...rotene and vitamin C, along with the trace mineral selenium which is also considered an antioxidant, were asso...lts, according to the researchers. An increase in selenium was associated with a 10 to 20 percent decrease in asthma prevalence. In youth with passive smoke e...

Most men over 40 take steps to try to prevent prostate cancer, Jefferson survey shows

...ods such as diet, exercise and supplements such as selenium actually help prevent prostate cancer. The researchers wanted to know what men do if anything to protect themselves from developing prostate cancer. The team surveyed two groups of men by either phone or mail and combined their data. In the study, ...

Study: Many men take dietary supplements to prevent prostate cancer

...D, and E (95%), minerals such as zinc, calcium and selenium (28%), and fruit/seed extracts such as saw-palmett...nationwide study to determine if the trace mineral selenium and vitamin E, either alone or in combination, can prevent prostate cancer. The study is ongoing a...

Chemoprevention backgrounder: Working for a future of cancer chemoprevention

...ncer prevention study ever undertaken - a study of selenium and vitamin E supplements in 32,400 men across the...ta from cell and animal studies also suggests that selenium "may slow the progression of subclinical prostate cancer, which is equivalent to prevention," says L...

Other highlights in the January 19 JNCI

... phase III randomized, placebo-controlled trial of selenium and vitamin E for the prevention of prostate cancer. The participants--32,400 men from the United States, Puerto Rico, and Canada--will receive supplements of selenium, vitamin E, or both for 7 to 12 years. They will be encouraged to receive annual p...

Antioxidants have no effect on Lou Gehrig's disease

...ine, 400 milligram of vitamin E and three 3 x 10-5 selenium doses each day. After combining all data from the three studies into one analysis, Orrell and colleagues concluded that antioxidant treatments did not significantly boost the survival rates of the studies' patients or improve their symptoms. The outc...

1

(Date:3/5/2015)... (PRWEB) March 05, 2015 Kevin Batsford ... by the grips of drug addiction. The siblings frequented ... their habits, and to seek refuge during the night. ... drugs, without consideration for his outward appearance, hygiene, or ... substances. CNY Central reported on Feb. 23rd ...
(Date:3/5/2015)... 05, 2015 The law firm of ... of the upcoming Crain’s Chicago Business Physicians' Breakfast on ... Breakfast will take place from 7:30 to 9:45 a.m. ... Chicago, IL 60611. The morning’s events will include a ... professionals. , The panel discussion is focused on ...
(Date:3/5/2015)... Wilmington, DE (PRWEB) March 05, 2015 ... and false weight loss promises is alarming, with more ... and products without an actual prescription, making it easy ... scams that simply take their money and endanger their ... simple questions before purchasing prescription online diet pills: , ...
(Date:3/5/2015)... Colorful packaging and marketing promises make it hard ... But all it really takes is reading the ingredient ... March 2015 Harvard Health Letter . , "Go ... of the Department of Nutrition at Harvard-affiliated Brigham and ... the markers of good nutrition. , Whole grains should ...
(Date:3/5/2015)... 2015 Daily Greens™, an organic ... smoothie line, Half Pint that will debut nationwide, ... Greens’™ current offerings, Half Pint is crafted with ... and other ingredients that are sourced locally whenever ... To preserve nutrients and extend shelf life, the ...
Breaking Medicine News(10 mins):Health News:The Homeless’ Unaddressed Drug Addiction Continues to Spiral Out of Control, Harbor Village Detox Stresses Treatment for the Homeless 2Health News:The Homeless’ Unaddressed Drug Addiction Continues to Spiral Out of Control, Harbor Village Detox Stresses Treatment for the Homeless 3Health News:Cook County Law Firm to Sponsor Physicians Breakfast 2Health News:Diet Doc Announces Four Simple Questions that Dieters Must Ask Prior to Purchasing Online Diet Pills 2Health News:Diet Doc Announces Four Simple Questions that Dieters Must Ask Prior to Purchasing Online Diet Pills 3Health News:Tips to Find the Healthiest Breakfast Cereals, From the March 2015 Harvard Health Letter 2Health News:Daily Greens™ Debuts Organic Cold-Pressed Smoothie Line for Kids Exclusively in Whole Foods Markets 2Health News:Daily Greens™ Debuts Organic Cold-Pressed Smoothie Line for Kids Exclusively in Whole Foods Markets 3
Other Tags
behaviorseducationalbakerfungidonekoreacomparingbogsdisablingminorgainingfaminevargervikpharmacologyhershjones