The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "shared" at medical news

Indiana University Cancer Center receives National Cancer Institute designation

...hip, research-related administrative functions and shared researchresources. The only NCI-designated Clinical Cancer Center in Indiana, it hasalready begun discussions of collaboration with Purdue University'sNCI-designated cancer research center. "The IU Cancer Center is an important building block in IU's...

Unprotected anal sex increasing in San Francisco

...ng the different transmissionrisk groups. Men who shared the same HIV status as their partners weresignificantly more likely to say they had unprotected sex because they were inlove. The high-risk group reported they had unprotected sex because condomswere unavailable, they were turned on, or they had bee...

Friends don't influence the prejudices and stereotypes of adolescents

... "First, friends are chosen mainly on the basis of shared activities and discussions of prejudice and stereotyping may be rare in adolescents' interactions with their friends, which would produce limited influence. Secondly, adolescents may influence each others' behaviors, but not their attitudes; there i...

Many Virginians would increase taxes for K-12 education, study finds

...urvey results demonstrate that it is not a concern shared by mostVirginians," says Alan E. Bayer, director of Virginia Tech's Center for SurveyResearch and co-investigator of the annual surveys. "Both local school boardsand state legislators should be aware of these poll results before makingpossibly unpopu...

UCSF Cancer Center joins elite group of National Cancer Institute-designated centers

...is money will help to fundresearch infrastructure, shared research facilities and administration at theUCSF Cancer Center. "NCI-designation is a testimonial to our commitment to translational andclinical research," says Frank McCormick, PhD, FRS, director of the UCSF CancerCenter. "It is also a recognition ...

Hospitalists should work with patients' primary care physicians, according to UCSF researchers

...protections for patients, such as confidentiality, shared medical decisionmaking, and patient autonomy. The hospitalist is a departure from the way doctors have traditionallyfunctioned in hospitals. In the past, patients' PCPs would manage theirinpatient care, however, with the hospitalist, the PCP no l...

Seniors need group housing, not homes

...benefitfrom group housing. Group housing includes shared residences; so-called congregate housing, in whichresidents have their own living quarters but share at least one meal a day andmay have access to organized social activities; assisted-living arrangements, inwhich residents might have some supervisio...

Workplace environment can improve eating habits

...ily recipes to meet low-fathigh-fiber criteria and shared them on the job at taste tests and recipecontests." As a result, the trial changed the atmosphere at the work site. In addition toincreased access to healthy food, employees experienced support from theirco-workers and from management for trying to ...

Women at high risk for breast cancer may avoid mammograms

...ty Medical Center. By pinpointing characteristics shared by many high-risk test-avoiders, theresearch sheds light on how to overcome hesitation in the population that canleast afford it. "We focused on high-risk women who worry about breast cancer, but who are notconscientious," said Marc Schwartz, Ph.D., ...

How the nose knows

...hey contain large, framework-like regions that are shared byall members of this enormous family of recognition devices. Itis only a small and well-defined region containing about 20 amino acids thatvaries greatly from one receptor to another. That's precisely the site where anodor molecule can fit like a ke...

Maternal Tissue Typing Could Improve Selection Of Kidney Transplant Donors

...s of recipients with those donated by siblings who shared only half of the recipients’ HLA antigens. The researchers found that long-term survival rates of HLA-identical kidneys were the same as HLA-mismatched kidneys, provided the donors’ mismatched HLA antigens were inher...

National Science Foundation Awards Knowledge And Distributed Intelligence Grants

...he effects of their actions. This ability must be shared by artificial agents, such as mobile robots, if they are to operate flexibly in similar environments. The main goal of the research is to undertake a detailed interdisciplinary study of sequential decision making across animals and robots, with a fo...

UCSF AIDS Research Center Receives Major New Grant From NIH

...R program is designed to provide anational pool of shared resources that is made available to AIDS researchers atthe local level. Through this network several major advances in AIDS researchhave evolved, including identification of new co-receptors for HIV, the role ofcytotoxic T-lymphocytes in early infec...

1 2 3 4 5 6 7

(Date:11/21/2008)...Newswire-USNewswire/ -- New research at West Virg... spitless tobacco product aimed at young adults is...RJ Reynolds, Camel Snus - touted as a socially acc...singly high levels of nicotine. , , "Camel ...products," said Bruce Adkins of the state Division...
(Date:11/21/2008)...swire-USNewswire/ -- U.S. News & World Report ...NCQA) ranked BlueChoice(R) HealthPlan of South Car...ans(TM), published in U.S. News & World Report...l ranking ranks the nation,s best health plans bas...QA accreditation scores. NCQA and U.S. News & ...
(Date:11/21/2008)...swire-FirstCall/ -- Barr Pharmaceuticals, Inc. (NY...overwhelmingly approved the proposals submitted to...Pharmaceuticals Industries Ltd. (Nasdaq: TEVA )....elming support of the transaction by the Barr shar...nd CEO. "We are pleased with the progress that we ...
(Date:11/21/2008)...y diseaseits cause remains a mysteryswept into Ath...citizens, soldiers and refugees of the war then ra...with corpses, social order broke down. Over the ne...ens lost a third of its population. It lost the wa...f the end of the Golden Age of Greece. , The Pl...
Breaking Medicine News(10 mins):Health News:Experts Say New Tobacco Product Targets Young Adults 2Health News:Experts Say New Tobacco Product Targets Young Adults 3Health News:BlueChoice HealthPlan Ranks in Top Third of America's Best Health Plans 2Health News:Barr Shareholders Approve Pending Teva Acquisition 2Health News:Barr Shareholders Approve Pending Teva Acquisition 3Health News:Barr Shareholders Approve Pending Teva Acquisition 4Health News:Study of ancient and modern plagues finds common features 2Health News:Study of ancient and modern plagues finds common features 3Health News:Study of ancient and modern plagues finds common features 4
Other Tagsalleviate 2alleviate 3alleviate 4alters 2alters 3alters 4alters 5alters 6alters 7orchestrates 2survived 2survived 3survived 4survived 5survived 6survived 7survived 8survived 9survived 10worsens 2smoke 2smoke 3smoke 4smoke 5smoke 6smoke 7smoke 8smoke 9smoke 10cigarette 2cigarette 3cigarette 4cigarette 5cigarette 6cigarette 7cigarette 8cigarette 9cigarette 10month 2month 3month 4month 5month 6month 7month 8month 9month 10rewarding 2
alleviatealtersorchestratesjudesnowballsurvivedsmearspapworsenssmokecigarettemonthyipsspellsrewardingmagnifies