Tag: "similar" at medical news

HIV vaccine trial breaks ground for future research

...binant construct of the HIV envelope glycoprotein, similar to the type of vaccine used to develop a vaccine f...d during the study, pre-treatment viral loads were similar in the placebo and vaccine groups over their follow-up visits. During analysis of various subgroups ...

Survivors who stop taking aspirin increase risk of another stroke

...(a statistically significant difference). Also, a similar number of patients in both groups were taking eith... have interrupted their aspirin than patients with similar risk factors but no new stroke or TIA. Seventy-seven percent of the ischemic strokes related to asp...

Third of European cancer patients use complementary and alternative therapies

...e five most frequently used broad categories being similar across most countries. Herbs were the most common treatment used in 13 of the 14 countries and the number one CAM treatment in nine. Most of the herbs were specific to each country. Homeopathy was among the top five in seven countries as were medici...

NHS Trusts meeting government target on stroke units 'in name only'

...ltidisciplinary meetings, and of those that did, a similar proportion were not attended by physiotherapists, occupational therapists, nurses, or senior doctors. Staffing levels and available skills also varied widely within the units, and the quality of care provided in some specialist stroke units often fai...

IDSA applauds Senate leadership for introduction of S. 3

...m (R-Pa.), and Jeff Sessions (R-Ala.). The bill is similar in purpose to legislation that Sens. Joseph Lieberman (D-Conn.) and Orrin Hatch (R-Utah) have been working on and soon plan to introduce. The bill has been dubbed "Bioshield II" because it would expand on "The Project Bioshield Act" ("Bioshield I"),...

Phobic anxiety increases heart disease death risk among women

...e decided that we would look to see if there was a similar relationship in women," said the study's lead author Christine M. Albert, M.D., M.P.H., assistant professor at Harvard Medical School, Boston.Albert and colleagues studied data from the Nurses' Health Study, a large survey about heart disease risk fa...

AHA urges earlier diagnoses, referrals for PCI in women

...e of blood vessels being successfully re-opened is similar to that in men," she said.The statement does not present specific recommendations for physicians, but compiles the latest evidence about the effectiveness of PCI in women. The panel identified three important areas for improving women's treatment: ...

Two studies find evidence that sunlight may have beneficial influence on cancer

...phoma from more than 3,000 lymphoma patients and a similar number of control subjects. They found that increased exposure to UV radiation through sunbathing and sunburns was associated with a decrease, rather than an increase, in the risk of non-Hodgkin lymphoma. Increased UV exposure was also associated, al...

Brain tumor treatment can vary greatly, according to new JAMA study

...says. "I hope in five or 10 years we can conduct a similar study and use this original work as a benchmark." She adds that with more research and education, she hopes that results for brain-tumor patients will continue to improve and that numbers for survival will look quite different in 10 years. In conjun...

Sunlight reduces risk of lymph gland cancer

... non-Hodgkin's, by some 30-40 per cent. "We find a similar correlation if we analyse responses by country or by skin-type," says Karin Ekstrm Smedby, postgraduate at KI's Department of Medical Epidemiology and Biostatistics. "This reduces the risk of systematic error and increases the credibility of our stud...

News Tips from the Journal of Neuroscience

...It has not escaped notice that this time course is similar to the antidepressant-induced enhancement of neurogenesis in the dentate gyrus and upregulation of brain-derived neurotrophic factor (BDNF) and its receptor trkB. In this week's Journal , Sairanen et al. assess BDNF- and trkB- mediated signaling in ...

Promise of 'bladder pacemaker' for people with spinal cord injury

...ies with cats. Those earlier studies showed that a similar reflex in bladder contraction exists in people with SCI. In January 2005, the National Institutes of Health awarded Grill a 5-year, $1.8 million grant to develop a system to sense involuntary bladder contractions and trigger a calming low-frequency e...

Smoking causes cognitive impairment in adolescents

...t daily smokers and 32 nonsmokers. The groups were similar in age, gender and education. "Adolescent smokers were found to have impairments in accuracy of working memory performance," Jacobsen said. Other studies show adult non-smokers and smokers have comparable focused, sustained and selective attention, ...

Infection in breast implants

...e Pittet comments: "Patients should be aware that, similar to other invasive procedures involving the implantation of foreign material, breast implants may lead to potential complications such as infection or capsular contracture. In good hands, however, infection remains infrequent."...

Sequential MDCT sufficient for determining possible risk of coronary artery disease

...r, and in most cases the results of the scans were similar enough that the patient would have been categorized with the same level of risk of developing coronary artery disease regardless of which scan was viewed," Dr. Halliburton said. However, in seven patients, the results varied from one scan to the oth...

Stents and going with the flow

...with a cost per quality-adjusted life-year that is similar to or higher than that of other accepted medical forms of treatment and carries a high incremental cost. In a related commentary, Brophy calculates that sirolimus-eluting stents could consume $75 million of our health care budget. Given the inconclu...

UC Irvine's undergraduate research programs receive $900,000 funding boost

...ationwide to receive grants earmarked for these or similar purposes. Last fall, UCI was among 36 schools recognized for its "Undergraduate Research/Creative Projects" by U.S. News & World Report. "These grants are a significant investment into our summer programs and reinforce UCI's place as a premier univer...

More Britons live alone

...71 and 1981, and among those of 35 44 there was a similar rise at each census between 1971 and 1991. For the 45 54 age band, it also doubled between 1981 and 1991. But the study argues that this is likely to reflect increases in both permanent sickness and living alone rather than a major trend towards p...

Association of herpesvirus with lung disorder questioned

...edicine that reported the presence of the virus in similar samples of lung tissue from a similar number of patients. Both primary pulmonary hypertension and infection with HHV-8 are uncommon, Katan...

Monkey 'pay-per-view' study could aid understanding of autism

...nly a tantalizing possibility, but we believe that similar processes are at work in these monkeys and in people. After all, the same kinds of social conditions have been important in primate evolution for both nonhuman primates and humans. So, in further experiments, we also want to try to establish in the s...

1 2 3 4 5 6 7 8 9 10

(Date:8/21/2014)... (PRWEB) August 21, 2014 Recently, ... among their patients. Alternative medicine is on the ... to millenials. According to The Fiscal Times, young ... treatments over conventional medicine. , The Fiscal Times ... many millenials are embracing alternative medicine. The article ...
(Date:8/21/2014)... with advanced laryngeal cancer appear to have better ... nonsurgical chemoradiation. , Author: Uchechukwu C. Megwalu, M.D., ... Mount Sinai, New York, and colleagues. , Background: ... are diagnosed each year and squamous cell carcinoma ... Prior to 1991, total surgical removal of the ...
(Date:8/21/2014)... NC -- Researchers have pinpointed the environmental source of ... Southern California for decades. It literally grows on trees. ... of a 13-year-old girl, who spent the summer gathering ... hardest hit by infections of the fungus named ... Cryptococcus , which encompasses a number of species including ...
(Date:8/21/2014)... (HealthDay News) -- Not only is eating better and exercising ... of health-care dollars a year, a new study finds. ... health sciences at Wake Forest Baptist Medical Center in Winston-Salem, ... 2 diabetes patients. Participants ranged in age ... an intensive "lifestyle change program" focused on diet and exercise, ...
(Date:8/21/2014)... The W. Montague Cobb/ NMA ... national voice in the elimination of health disparities, ... the 112th National Medical Association’s (NMA) Annual Convention ... John Ruffin, Ph.D, former Director of the National ... life-long career and innovations have had a significant ...
Breaking Medicine News(10 mins):Health News:Van Uden Center Sees Growth in Alternative Medicine 2Health News:Surgery associated with better survival for patients with advanced laryngeal cancer 2Health News:Fungus deadly to AIDS patients found to grow on trees 2Health News:Getting Healthier a Big Money-Saver for People With Diabetes 2Health News:W. Montague Cobb/NMA Health Institute Honors Three Outstanding Leaders in Health Disparities 2
Other Tags
titantedstinkyhypertensivesdiesellaybeachremovesaceseekpreliminarymitralagesfactquotationsretarded