The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "space" at medical news

Age-related muscle loss linked to protein interplay, says Stanford researcher

...to ways of preventing atrophy from immobilization, space flight or simply due to aging. "What you really want to do is maintain the youthfulness of the regeneration pathway," said Thomas Rando, MD, PhD, associate professor of neurology and neurological sciences and an investigator at the Veterans Affairs P...

Space science joins battle against cancer

...er light from a planet can be detected. European space scientists have now developed the technique even f...ous growths. This will not be the first time that space technology has been used in the fight against cancer. A computer program originally developed by Eur...

Global Monitoring for Environment and Security: 4th forum in Baveno, Italy

...s on, GMES has developed from a loose gathering of space organisations to a cohesive structure fully involv...in Europe involved in the use of observations from space and in-situ facilities for better management of the environment and enhanced security of Europe's ci...

UF 'smart home' demonstrates concept of automated elderly help and care

...building. Built into this cozy but complete living space is a mind-bending array of experimental assistive-living devices, ranging from a microwave that recognizes entrees and automatically determines how long to cook them to sensors that track an elderly person's whereabouts in the home. These devices are...

Poor neighborhood linked to poor heart attack survival

...nd low-cost healthful foods, and inadequate public space for physical activity may be some factors involved in the higher risk of death after heart attack among those living in poverty, Tonne said. "The precise pathways by which poverty at the neighborhood level affects survival have not yet been identifie...

Telemedicine and e-learning put communities in touch

...uary. The aim is to evaluate the potential role of space infrastructure for the development of Europe's regions. Two ESA funded projects have been invited to demonstrate their potential for France; both with proven contributions to bridging the Digital Divide. TeLeCare from Canada is a telemedicine projec...

Neutron detector under development to monitor spacecraft radiation

...der to detect and can penetrate more deeply into a space traveler's body producing an increased risk of cancer, DNA damage and central nervous system damage," said Maurer, principal staff member at The Johns Hopkins University Applied Physics Laboratory, Laurel, Md., and principal investigator on the proje...

Brain signals from the paralyzed or injured captured by computer

...irect brain control to control a robotic arm in 3D space while watching the movement in virtual reality, the researchers are now moving on to have the animal see and control the arm directly, without the virtual reality display. Although learning to use the robot as a tool seems to be more difficult for th...

New CDC-funded HIV program at UNC integrates treatment with prevention

...egin this program, Quinlivan said. Now in a larger space with more examination rooms, the clinic has three rooms dedicated for interviewing or counseling. In addition, via a program funded by the U.S. DHHS's Substance Abuse and Mental Health Services Administration, a study is under way to determine if on-...

OHSU doctors use 'putty' to prevent hemorrhagic stroke

..., a type of stroke in which blood escapes into the space between the brain and the skull, cutting off its flow to the brain. A common treatment for an aneurysm is coiling, in which a tiny platinum coil is inserted into the sac through a catheter and deployed, restricting blood flow into the malformation. B...

HHS awards $14 million to support Bioethics Research Center

...nsolidate the center into one location and provide space for the Bioethics Living Learning Complex. The complex will house visiting scholars and interns who participate in bioethics programs. Participants will include representatives from various health professions, including public health, veterinary me...

American Thoracic Society Journal news tips for October 2003 (second issue)

...high-dose antibiotics to an individual's bronchial space and limited systemic absorption and toxicity. These details are part of a comprehensive "State of the Art" article on the "Pathophysiology and Management of Pulmonary Infections in Cystic Fibrosis." The report is published in the second issue for O...

Researchers fly away from gravity on the 35th ESA Parabolic Flight Campaign

... 10 minutes of weightlessness per day. Rockets and space flights provide much longer and continuous weightl...o do for long-term manned missions. Testing for space Several experiments are testing hardware destined for the International Space Station (ISS). One w...

HFES Annual Meeting papers feature work on critical health and safety issues

...overnor's Square 16 A key safety component of the space shuttle is a complex computerized Caution and Warn...ing System, which is responsible for notifying the space shuttle crew of possible problems through auditory and visuals alerts. This study describes recent u...

A healthcare software solution to improve follow-up care of patients

...ll eating and can become critically ill within the space of three weeks." This is a common problem, but one that requires hospitalisation, a costly process that can take weeks. Using this new computing tool, the patient's doctor could alert the hospital when they think the patient is in danger and the hosp...

NIAID funds construction of biosafety laboratories

... amount of biosafety level 3 (BSL-3) and BSL-4 lab space as a significant barrier to progress. "With input ... laboratories will give these dedicated scientists space to conduct this critical research, and equally important, they will be able to conduct it safely." ...

Nanoneurosurgery, search for E-T life, bioscan technology and home holograms at frontiers of optics

... Angel from the University of Arizona, "Ground and space telescopes to observe extra-solar planets" Gerald ...working to make such a telescope and to send it to space sometime in the coming decade." (Paper ThW3, Thursday, 11 AM) Improvements in Face Recognition T...

A picture perfect test of well-being: Graphic assessment tool tunes into life satisfaction

...osite a butterfly, a lion opposite a mouse. In the space between the oppositional images are seven unnumbered and conjoined boxes that comprise a scale along which participants are asked to mark the place on the scale that best describes how they feel. For scoring purposes each box on each of the 10 sets ...

The Passionate Mind: Oct. 9-11 Utah Symposium in Science & Literature

...broadcast, panel discussions and other events, but space is limited. Sothose who wish to attend should regi...of the School ofBusiness, and may be competing for space with fans attending a footballgame later in the day. The symposium is sponsored by the Universit...

On the horizon of glucose monitoring: A review

...iration can also affect fluids in the interstitial space and influence the measurements. Continuous but invasive glucose monitoring: Continuous glucose monitoring can have significant advantages. For example, the management of a glucose value of 150 mg/dL (target is about 80-120 mg/dL) during a rapid decli...

1 2 3 4 5 6 7 8 9 10

(Date:11/21/2008)...Newswire-USNewswire/ -- New research at West Virg... spitless tobacco product aimed at young adults is...RJ Reynolds, Camel Snus - touted as a socially acc...singly high levels of nicotine. , , "Camel ...products," said Bruce Adkins of the state Division...
(Date:11/21/2008)...swire-USNewswire/ -- U.S. News & World Report ...NCQA) ranked BlueChoice(R) HealthPlan of South Car...ans(TM), published in U.S. News & World Report...l ranking ranks the nation,s best health plans bas...QA accreditation scores. NCQA and U.S. News & ...
(Date:11/21/2008)...swire-FirstCall/ -- Barr Pharmaceuticals, Inc. (NY...overwhelmingly approved the proposals submitted to...Pharmaceuticals Industries Ltd. (Nasdaq: TEVA )....elming support of the transaction by the Barr shar...nd CEO. "We are pleased with the progress that we ...
(Date:11/21/2008)...y diseaseits cause remains a mysteryswept into Ath...citizens, soldiers and refugees of the war then ra...with corpses, social order broke down. Over the ne...ens lost a third of its population. It lost the wa...f the end of the Golden Age of Greece. , The Pl...
Breaking Medicine News(10 mins):Health News:Experts Say New Tobacco Product Targets Young Adults 2Health News:Experts Say New Tobacco Product Targets Young Adults 3Health News:BlueChoice HealthPlan Ranks in Top Third of America's Best Health Plans 2Health News:Barr Shareholders Approve Pending Teva Acquisition 2Health News:Barr Shareholders Approve Pending Teva Acquisition 3Health News:Barr Shareholders Approve Pending Teva Acquisition 4Health News:Study of ancient and modern plagues finds common features 2Health News:Study of ancient and modern plagues finds common features 3Health News:Study of ancient and modern plagues finds common features 4
Other Tagsalleviate 2alleviate 3alleviate 4alters 2alters 3alters 4alters 5alters 6alters 7orchestrates 2survived 2survived 3survived 4survived 5survived 6survived 7survived 8survived 9survived 10worsens 2smoke 2smoke 3smoke 4smoke 5smoke 6smoke 7smoke 8smoke 9smoke 10cigarette 2cigarette 3cigarette 4cigarette 5cigarette 6cigarette 7cigarette 8cigarette 9cigarette 10month 2month 3month 4month 5month 6month 7month 8month 9month 10rewarding 2
alleviatealtersorchestratesjudesnowballsurvivedsmearspapworsenssmokecigarettemonthyipsspellsrewardingmagnifies