The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "stick" at medical news

Managing anger, boosting activity helps substance abusers stick with treatment

...esearch has repeatedly shown that participants who stick with their treatment programs for the longest times are most likely to recover and not relapse, explains lead author Carolynn Kohn, Ph.D., of the Kaiser Permanente Division of Research. Prior research also has shown that people whose basic approach t...

Benefits of exercise lead to further activity in elderly

...ogram, it did not predict which participants would stick with their regimen. But, when measured as a function of improvements seen during early participation in the program, exercise self-efficacy did predict who would still be exercising a year later. "These results indicate that how confident one is when...

Cervical tissue changes may explain false negative pap smears

...a molecule that helps cells in the cervical tissue stick together, Felix explains. Normally, E-cadherin can be found in cervical tissue, except on the cervix's surface (the superficial epithelial layers). With no E-cadherin there, older cells can detach and slough away from the surface of the cervix, much ...

American Heart Association weighs in on fat substitutes

...rcially baked goods, such as crackers, cookies and stick margarines. At present, trans-fat content is not part of the FDA's label requirement....

Understanding cancer patients' needs, concerns, is key to improving clinical trial participation

...o be more satisfied with their treatment -- and to stick with a clinical trial through its completion, Paterniti said. Previous research by UC Davis Cancer Center investigators, published in the March 13, 2001 issue of the Journal of Clinical Oncology, found that both doctors and patients sometimes hold m...

Cancer drug proves effective in treating sickle cell disease

...on a characteristic crescent, or sickle, shape and stick to blood vessel walls. As a result, the cells cannot squeeze through capillaries. Blood supply is blocked, depriving tissues and organs of oxygen and causing short- and long-term damage. Patients suffer episodes of intense pain, typically in the arms...

Artificial organs

...nto the empty channels in the scaffold, where they stick to the walls. These cells grow in a nutrient to form a network of blood vessels within the scaffold which itself dissolves over a few months, leaving behind a functioning liver-at least, that's the aim. So far, only blood vessel networks grown this w...

As heart patients flock to alternative medicine, hazards may lurk

... more than the general population, even while they stick to mainstream drugs too, says Eva Kline-Rogers, R.N., M.S., the U-M nurse practitioner who coordinated the study. But they may not know that some of these substances could pose a hazard when taken with certain heart medications, and if they dont tell...

Hopkins study dispels 'panic' myth and suggests ways to involve public in response to a bioterrorist attack

...ing social structures and routines. People tend to stick to the standards of civil behavior and their normal social roles even under the most challenging circumstances. Following the anthrax attack, sales of Ciproflaxacin and gas masks increased dramatically. This was not a panic reaction. Based on the cir...

Smaller hospitals OK for heart bypass surgery - if your risk is small

...etter off at high-volume hospitals, but others can stick closer to home ANN ARBOR, MI - Learning you have to have a heart bypass operation is scary enough. But now, a new study may take some of the fear out of choosing where to have the operation. Researchers from the University of Michigan Health Syste...

Researchers closer to delivering new insulin pill for diabetics

...to the blood. "If we don't have these 'anchors' to stick in the upper small intestine and hold the particles for a little while, they will pass through and the medication will never release in the upper small intestine," said Nicholas A. Peppas, Purdue's Showalter Distinguished Professor of Chemical and Bi...

Science, engineering and technology news tips -- August 2001

... the same way. The misfolded proteins build up and stick together, forming mats and tangles in the brain. Graduate student Alex Slepoy and colleagues built a mathematical model of prion growth. They set rules for how a few infectious prions convert normal PrP proteins around them. As more proteins are alt...

New materials could mean longer lasting artificial hips

...ssentially turn inside out and flatten in order to stick as tightly as possible to the surface," Spencer said. "This makes them much less effective as lubricants and increases friction and wear in the hip implant." "Now that we've established that the nature of the polyethylene surface plays a role...

Unergrad's invention may deliver life-saving medicine

... to produce microspheres that are light and do not stick together when shot out of an aerosol device. The spheres must be capable of carrying large molecules such as DNA and proteins deep into the lungs, where they can be released into the body over a prescribed period of time. Krauland hopes to have resul...

Aspirin and other non-specific COX inhibitors may slow atherosclerosis

...orm of the enzyme in platelets -- blood cells that stick together in the first stages of clotting. Suppression of the platelet COX-1 product, thromboxane, is how aspirin protects against heart attack and stroke. The COX-2 enzyme produces prostacyclin, a hormone-like substance that might work against athero...

Gender-specific intervention may be needed to improve diets of african-american youth

...er levels of family support than those who did not stick with it. We are concerned about the epidemic proportions of high blood pressure in the African American community and believe one way to stem the tide is to help young people develop good dietary habits, said lead author Dawn K. Wilson, PhD. We fo...

VA trial to weigh aspirin against other anti-clotting drugs in heart disease patients

...grel both work against platelets, blood cells that stick together and encourage clotting. Aspirin helps prevent platelets from clumping together. Clopidogrel prevents platelets from being activated, and while some studies show it works better than aspirin, it is also more expensive. Aspirin and warfarin...

Can the body trick the body into an autoimmune response to thwart HIV?

... diseases. The researchers discovered that if you stick a human protein on a virus, the body won't recognise it as one of its own. Instead, it will create antibodies against what it thinks is a viral protein, says John Schiller of the National Cancer Institute near Washington DC. Using this strategy, Schi...

Honey as medicine

...ting evenwith quite large wounds. Honey does not stick to the underlying wound tissues, so there is no tearing away of newlyformed tissue, and no pain, when dressings are changed. Honey has an anti-inflammatory action, which reduces the swelling around a wound. This improvescirculation and thus hasten...

UI researchers find way to possibly improve effectiveness of gene transfers

...archers have had difficulty getting the vectors to stick to the cells. "The major problem is that the viruses we use to carry in a gene don't bind very well to the airway cells," Welsh said. "The first challenge is to improve binding." There are two ways to solve the binding problem, Welsh explained. Resea...

1 2 3 4

(Date:11/21/2008)...Newswire-USNewswire/ -- New research at West Virg... spitless tobacco product aimed at young adults is...RJ Reynolds, Camel Snus - touted as a socially acc...singly high levels of nicotine. , , "Camel ...products," said Bruce Adkins of the state Division...
(Date:11/21/2008)...swire-USNewswire/ -- U.S. News & World Report ...NCQA) ranked BlueChoice(R) HealthPlan of South Car...ans(TM), published in U.S. News & World Report...l ranking ranks the nation,s best health plans bas...QA accreditation scores. NCQA and U.S. News & ...
(Date:11/21/2008)...swire-FirstCall/ -- Barr Pharmaceuticals, Inc. (NY...overwhelmingly approved the proposals submitted to...Pharmaceuticals Industries Ltd. (Nasdaq: TEVA )....elming support of the transaction by the Barr shar...nd CEO. "We are pleased with the progress that we ...
(Date:11/21/2008)...y diseaseits cause remains a mysteryswept into Ath...citizens, soldiers and refugees of the war then ra...with corpses, social order broke down. Over the ne...ens lost a third of its population. It lost the wa...f the end of the Golden Age of Greece. , The Pl...
Breaking Medicine News(10 mins):Health News:Experts Say New Tobacco Product Targets Young Adults 2Health News:Experts Say New Tobacco Product Targets Young Adults 3Health News:BlueChoice HealthPlan Ranks in Top Third of America's Best Health Plans 2Health News:Barr Shareholders Approve Pending Teva Acquisition 2Health News:Barr Shareholders Approve Pending Teva Acquisition 3Health News:Barr Shareholders Approve Pending Teva Acquisition 4Health News:Study of ancient and modern plagues finds common features 2Health News:Study of ancient and modern plagues finds common features 3Health News:Study of ancient and modern plagues finds common features 4
Other Tagsalleviate 2alleviate 3alleviate 4alters 2alters 3alters 4alters 5alters 6alters 7orchestrates 2survived 2survived 3survived 4survived 5survived 6survived 7survived 8survived 9survived 10worsens 2smoke 2smoke 3smoke 4smoke 5smoke 6smoke 7smoke 8smoke 9smoke 10cigarette 2cigarette 3cigarette 4cigarette 5cigarette 6cigarette 7cigarette 8cigarette 9cigarette 10month 2month 3month 4month 5month 6month 7month 8month 9month 10rewarding 2
alleviatealtersorchestratesjudesnowballsurvivedsmearspapworsenssmokecigarettemonthyipsspellsrewardingmagnifies