Tag: "study" at medical news

Patients newly diagnosed with HIV are more likely to enter outpatient care with case management

...cent of patients in the case-management arm of the study visited an HIV clinician at least once within 6 mo...ospital and principal investigator for the Atlanta study site. "This is the first trial to compare head to head the typical passive referral with a time-lim...

UW study shows blacks and Latinos are more satisfied with physicians of the same race

...rom the same race or ethnicity, according to a new study published in the March-April edition of the Annals of Family Medicine. In analyzing a national survey of more than 3,800 blacks, Latinos and whites, Dr. Frederick Chen, acting assistant professor in the University of Washington School of Medicine, a...

Brain activity prior to treatment flags vulnerability to antidepressant side effects

...peer-reviewed journal Neuropsychopharmacology, the study is the first to link brain function and medication... could arise from only non-medication factors. The study enrolled 32 healthy subjects who had never suffered from depression. All underwent a one-week, singl...

Study finds that coordinating care of chronically ill patients does not increase liability

...empt care coordination. That is one finding from a study by Mark Hall, J.D., of Wake Forest University Baptist Medical Center. But many doctors believe otherwise. "A representative national sample of 1,238 practicing physicians found that 49 percent listed legal liability as one of the two main barriers t...

March/April 2005 Annals of Family Medicine tip sheet

... the best choice for everybody, according to a new study out of the Medical University of South Carolina. A...for only a modest portion of the effect. While the study does not seek to disentangle the contribution of specific family-level determinants to health status...

Physicians may not be accurate in their confidence levels of their diagnoses, says Pitt study

...o help that is offered," he said, noting that this study is not about how often physicians are correct, but... technology," Dr. Friedman said. "While this was a study performed in the laboratory and not in the clinic, the apparent prevalence of overconfidence represe...

Do minorities survive hospitalization better than others?

...rican-Americans than for non-Hispanic whites, in a study published in the current issue of The American Jou... other studies of risk factors for mortality." The study is reported in "Adjustment for Do-Not-Resuscitate Orders Reverses the Apparent In-Hospital Mortality...

Unexpected benefit seen in treating HER-2 breast cancer with new preoperative drug combo

...eight who continued to receive treatment after the study had been halted, 26 percent in the chemotherapy ar...east cancer, Buzdar says. Patients enrolled in the study were randomized to four cycles of paclitaxel followed by four cycles of fluorouracil, epirubicin and...

Mouse model reveals potential way to reduce cardiac deaths in kidney patients

...s are just entering initial clinical trials." The study will appear in the April issue of the Journal of t... cardiovascular complications," Hruska says. "This study shows us that by treating the skeleton or otherwise decreasing phosphorous levels, we have the poten...

OHSU scientists test medication to treat involuntary weight loss

...believe the results obtained in this collaborative study with OHSU will provide an important proof-of-principle for Neurocrine's small molecule MC4 receptor antagonist program in animal models relevant for cachexia," said Alan C Foster, Ph.D., Neurocrine Fellow and head of Neurocrine's neuroscience group. ...

Cultural and social factors influence prostate cancer treatment

...tients' prostate cancer treatment decisions. A new study published in the May 1, 2005 issue of CANCER ( htt...red with radiation. The authors summarize, "This study confirmed the hypothesis that sociocultural factors add significant explanatory power to traditional...

Consumers with disabilities empowered by American Disabilities Act

...r the years 1994-1998 in public transportation. A study publishing in the latest issue of the Journal of C...of the Americans with Disabilities Act (ADA). The study asks those for whom the policy was designed how well the policy works. The authors examined the res...

Uric acid and heart disease

...Association, report the single largest prospective study addressing the role of uric acid in heart disease. The debate over the role of uric acid in heart disease has been going on for more than 50 years, starting with a paper published in 1951 which found higher serum uric acid concentrations in patient...

Lack of clinical trial participation may contribute to lower survival rates

A new study finds poor survival rates among young adults and o...n 35-44 years. The authors conclude, "based on the study reported here and others in leukemias, brain tumors, and cancer in general, lack of clinical trial p...

A marker for new blood vessel formation in tumors

...ork, in a mouse with human melanoma and in a small study of patients with tumors including melanoma, suggests that the marker is truly reflecting the in vivo level of the integrin. Hence the marker could be used to identify tumors that express this marker, assess the degree of new vessel formation in tumor...

Primary care office strategies may increase colon cancer screening

...sts (34.4 percent to 43.2 percent). Throughout the study period, the use of posters and brochures about CRC screening increased from 20.5 percent to 69.3 percent. The most common method for educating the patient was direct discussion of screening (96.1 percent). The researchers also found improvements in t...

Professionalism and professional ethics in medicine

... the JAMA/Archives journals. "Several years ago, a study conducted by a group at Vanderbilt University demo... Medicine, in an accompanying editorial. "The same study also suggested that practice volume, translating into less time available for each patient, was asso...

Advertising by academic medical centers may risk eroding public trust, says study

...orwardness of these advertisements, according to a study by researchers at the Veterans Affairs Medical Center and Dartmouth Medical School (DMS). Several of the ads promote services of unclear health value to the public and, in some cases, seem to place the financial interests of the medical centers befo...

Economist: Cuba's state-run baseball doesn't go to bat for players

...rsity of Washington, Tacoma, and author of the new study on Cuban baseball. "Cuba's system makes a great case study of how organizing sports through non-market rules has unintended consequences." According to Baird'...

Raw food vegetarians have low bone mass

...se they take in fewer calories." Fontana says more study is needed to prove that raw food vegans have light-but-healthy bones. One study could involve following large groups of them for years to look at fracture rates. Other, more immine...

1 2 3 4 5 6 7 8 9 10

(Date:10/25/2014)... -- Researchers who discovered antibiotics in farmed and ... concern. The use of antibiotics in animals, ... contribute to the development of antibiotic-resistant bacteria that ... the study. Each year in the United ... and kill about 23,000, according to the Infectious ...
(Date:10/22/2014)... 2014 At a time when the ... and athletes at all levels, the UPMC Sports ... current discussion where two powerful messages are lost: Concussions ... result in full recoveries every day. , In striving ... fact and research, UPMC and the Concussion Program are ...
(Date:10/22/2014)... 22, 2014 For Dr. Iris Hunter, a ... it’s an extension of her life’s mission. Her extensive experience ... the owner of FirstLight HomeCare, make it clear that Hunter’s ... me that my work makes a difference in the lives ... spirit, so after much research, I felt ready to start ...
(Date:10/22/2014)... October 22, 2014 Hay House is pleased ... Addiction and Upgrade Your Life (Paperback; $10.82) written by the ... & Recovery. This book is meant to help readers ... life of recovery. , Recovery 2.0 is not the ... Recovery 2.0 is a guide for what comes next. ...
(Date:10/22/2014)... Losing Weight Your Body’s Way , In ... in the face, it certainly can be difficult to choose ... an extra favor by doing it the healthy way? Set ... listen to your body, exercise regularly, and choose foods with ... losing weight; you need to exercise more and eat less. ...
Breaking Medicine News(10 mins):Health News:Researchers Say Antibiotics in Fish a Health Concern 2Health News:University of Pittsburgh Medical Center Launches Initiative to Emphasize Concussions Are Treatable 2Health News:University of Pittsburgh Medical Center Launches Initiative to Emphasize Concussions Are Treatable 3Health News:University of Pittsburgh Medical Center Launches Initiative to Emphasize Concussions Are Treatable 4Health News:Dr. Iris Hunter to Host Grand Opening of FirstLight HomeCare Tomorrow 2Health News:Hay House Announces The Official Release of Recovery 2.0: Move Beyond Addiction and Upgrade Your Life 2Health News:Hay House Announces The Official Release of Recovery 2.0: Move Beyond Addiction and Upgrade Your Life 3Health News:ReductionGuruMD Presents Ways to Improve Your Weight Loss Results 2
Other Tags
doublecortindirectingpayloadsstsmaintenancetelomerealivedrunkenapplesdevicewidelyisraeliimpactmonitoringneurodegenerativeions