Tag: "sufficient" at medical news

Successful, rapid protein crystallization possible with technique developed by UCSD researcher

... provided data and analysis for 21 of the proteins sufficient to localize unstructured regions in the proteins, information that typically takes months, if not years, to obtain. Recent studies have shown that many, if not the majority of proteins contain some unstructured, or unfolded regions of amino acid se...

Black tar heroin use explains lower HIV levels among injection drug users in the Western US

...ng to research done elsewhere. This temperature is sufficient for killing the HIV virus, which limits the likelihood of HIV transmission through sharing of drug preparation paraphernalia, according to the UCSF researchers. In addition, black tar heroin clogs syringes, they note. Frequent rinsing and flushing is...

New guidelines for drug studies for relapsed prostate cancer patients

...valuated in trials are ones that have demonstrated sufficient clinical activity as measured by a stabilized or declining PSA for a sufficient number of patients in a specified time. The Working Group's recommendations are published in the Feb...

UCL study establishes common biological ground for maternal and romantic love in humans

...uro-hormones have been shown in animals to be both sufficient and necessary to induce both mother-infant bonding and male-female bonding. The new research therefore provides a link to the previous work on animals, showing that the same 'love-potion,' produced by the brain, known to work in animals is also at w...

New flu vaccine provides insight into immunity development

...ncies increased the number of people it considered sufficient to demonstrate the product's safety after the vaccine was already in late stages of development, prolonging the process. Because of its genetics, Greenberg said, the flu virus has the ability to outsmart the host immune system, which makes it a movin...

Significant disparities still exist in screening mammography rates; minorities underestimated

...nders. Her analysis found that these numbers were sufficient in 51 states for whites but only 35 states for African Americans; 36 states for Hispanics; 11 states for Native Americans; and 10 states for Asian Americans. "Both BRFSS and NHIS studies rely on self-reported health behavior, which may not accur...

Insulin-producing cells found in a variety of tissues in diabetes

...a brief three-day period of high blood glucose was sufficient to nudge the cells outside the pancreas to produce insulin. If this inherent property of cells can be harnessed and augmented, Chan speculates, scientists could it to generate insulin-producing cells from other tissues for the treatment of diabetes...

Research examines treatment goals for acromegaly patients

... desired level in acromegaly patients, may not be sufficient to define a biochemical remission of acromegaly. "Our findings indicate that a GH measurement of 1 g/liter post-glucose load fails to identify a significant proportion of postoperative acromegalic patients who still suffer from the disease, which is...

Scientists find HIV-blocking protein in monkeys

... determined that TRIM5-alpha is both necessary and sufficient to block HIV replication. Although the precise mechanism of TRIM5-alpha's activity is not fully determined, says Dr. Sodroski, it may be that the protein chops up HIV's capsid and thwarts the orderly uncoating the virus must undergo before proceeding...

Randomisation phase of the DIRECT programme (DIabetic REtinopathy Candesartan Trials) completed

...retinopathy. However, a properly designed trial of sufficient size is needed to evaluate the role of RAS modulation in the treatment of this condition. Candesartan cilexetil was chosen for DIRECT because it may offer a more complete blockade of the RAS with improved tolerability. Dr Michael George, Deputy Mana...

Cedars-Sinai March medical tipsheet

...ed that an X-ray image of the fallopian tubes is a sufficient diagnostic tool when a woman with irregular or absent ovulation fails to become pregnant after a trial of fertility pills (clomiphene citrate). If the tubes appear to be open, patients may then undergo more months of hormonal therapy, followed by in ...

Implantable cardiac defibrillator use significantly lowers heart failure mortality

...the heart muscle resulting in an inability to pump sufficient blood through the body. Patients with CHF also have a higher risk of abnormal heart rhythm, known as arrhythmia, which often leads to sudden cardiac death. About half of all CHF patients who die do so from sudden cardiac death. "With the population g...

'Neutraceuticals'...coming soon to a dentist near you?

... on an assay for total anti-oxidant capacity, with sufficient sensitivity to permit analysis of gingival crevicular fluid as well as plasma compartments. With collaborators, he has developed a regression model that allows for the prediction of total anti-oxidant capacity from individual anti-oxidant components ...

Waiting between breast cancer diagnosis and treatment

...st of the cancer care system, while still allowing sufficient time for digesting information and recovering from procedures....

Workload, fatigue and physical stress on physician residents in training

...urrent limitations on residents' hours of work are sufficient to ensure physician and patient safety....

Doctor attacks South African government for failing women while spending billions on arms deals

...sts that more lives could be saved if a study with sufficient power proves feasible. We may need about 30-50,000 women in total to provide a statistically significant answer." Dr Boulos concluded: "A substantial segment of women in the community are resistant to attempts to involve them in the whole process of...

First national sleep conference March 29-30 explores sleep's role in public health

...irector Dr. Carl Hunt. "Even if you personally get sufficient sleep to feel refreshed each day, chances are you interact with someone who has a sleep problem. It could be your mother, whose sleep apnea increases her chances of developing heart disease; your carpool driver, who might be at increased risk for a c...

Sufficient evidence for reducing sugar intake to tackle obesity?

...my and it is clearly important to consider whether sufficient evidence indeed exists to recommend restriction of intake. Thus, although none of the individual studies might be definitive, when considered in aggregate they provide considerable evidence to suggest that sucrose and other free sugars contribute to ...

National Academies news: Clinical research involving children

...rents and, when appropriate, children should allow sufficient time for questions and explanations of research protocols, the report emphasizes. In addition, IRBs should adopt explicit written policies on payments for research participation. It is appropriate to reimburse families for expenses related to resea...

Institute of Medicine Advisory: April 1 public briefing on safety of dietary supplements

... entails. Congress should provide the agency with sufficient funding to collect and analyze data and carry out the consumer protection and education responsibilities mandated by DSHEA. Annual sales of dietary supplements in the United States are approaching $16 billion. An average of 1,000 new product...

1 2 3 4 5 6 7 8 9 10

(Date:12/20/2014)... 20, 2014 Parker & Sons, Inc. ... years of experience in contractor services announces reaching a ... for the homeowners of Arizona. Parker and Sons is ... contractor technicians that make customer service the number one ... Arizona and started with one service vehicle and has ...
(Date:12/19/2014)... (PRWEB) December 19, 2014 Sub Zero Ice ... sponsor a blood drive Sunday the 28th from 2pm-6pm at ... & Sawyer Road in Sarasota, FL. , Inquiries regarding time ... you for participating in the donating process, Sub Zero Ice ... flash frozen, custom ice cream. , About Sub Zero Ice ...
(Date:12/19/2014)... 2014 Eufaula, Oklahoma, located just 9 ... the state’s largest lake with more than 600 miles ... to a little more than 3,000 residents, hosted its ... the 6th of December. , Featuring Santa, Christmas lights ... Eufaula on Main Street. Narconon Arrowhead’s parade float ...
(Date:12/19/2014)... warns parents that buying an older car for their teens may ... drivers killed in the United States between 2008 and 2012 were ... lacked important safety features that are available on newer cars, the ... were in cars at least six years old, 34 percent were ... cars 11 to 15 years old, and 17 percent were in ...
(Date:12/19/2014)... 2014 (HealthDay News) -- Dense bunches of bacteria called biofilms ... new study finds. The researchers said these biofilms ... The presence of these biofilms may represent an increased ... to predict a person,s risk for the disease, the researchers ... these biofilms may coat the mucus layer of cells lining ...
Breaking Medicine News(10 mins):Health News:Parker & Sons Announces Reaching A Milestone By Providing 40 Years Of Dedicated Contractor Services For Homeowners Of Arizona 2Health News:Parker & Sons Announces Reaching A Milestone By Providing 40 Years Of Dedicated Contractor Services For Homeowners Of Arizona 3Health News:Shark Tank’s Sub Zero Ice Cream Sponsors Blood Drive 2Health News:Narconon Arrowhead Debuts Float at Checotah and Eufaula Christmas Parades 2Health News:Narconon Arrowhead Debuts Float at Checotah and Eufaula Christmas Parades 3Health News:Older Cars a Bad Choice for Younger Drivers 2Health News:Could Bacteria Play a Role in Colon Cancer? 2
Other Tags
interfacebalancelonglinecasualtiesadversarycommerciallymirrorcletarcevashuntsalertssilenceamplifymetalsthinksvolunteersfully