Tag: "sugars" at medical news

Chemical decoy shows promise for slowing Alzheimer's by acting as decoy

...ntially binds to sialic acids, naturally occurring sugars that have increasingly been shown to be involved in many cell activities, including signaling and differentiation. Sialic acids are particularly abundant on the surfaces of brain cells but also found in lower amounts in the rest of the body. The rese...

Study shows acrylamide in baked and fried food does not increase risk of breast cancer in women

...ult of a reaction between specific amino acids and sugars found in foods when heated to high temperatures. It's found in foods such as potato chips, French fries, cereals, breads, biscuits, coffee and meatballs, among others. The researchers found that the amount of acrylamide eaten in the diet did not pose...

Young blood revives aging muscles, Stanford researchers find

...ine," he said. With thousands of proteins, lipids, sugars and other small molecules in the blood serum, deciding where to look first would be tantamount to a roll of the dice. What's more, there's no evidence that the same blood component is responsible for reviving the different types of cells. "Another ap...

Added sugar displaces food groups lowering quality of preschooler diets

...ntake of calcium. The researchers note that added sugars are mostly invisible in foods and can surprise caregivers when presented in teaspoons. For example, the average added sugar intake of the two and three year olds in the study was 13.5 teaspoons and the average intake of the four and five year olds w...

Low-glycemic load diet may improve ability to stay on diet longer

Low-glycemic load diets, those low in sugars with moderate levels of carbohydrates and not as low in fat and protein, may lower metabolism less when compared with low-fat diets, making the dieters feel less tired, cold and hungry, as well as improve cardiovascular risk factors, according to an ...

Molecular clock genes influence metabolism of sugar and dietary fats

...e an important role in governing the metabolism of sugars and fats within the body. They found in mice that two of the well-studied proteins in the clock control the ability of animals to recover from the fall in blood sugar that occurs in response to insulin. The investigators demonstrate a role fo...

Center refutes finding that added sugars displace vitamins and minerals

Alexandria, Va., Oct. 7, 2004 -- Added sugars have little or no substantive effect on diet quali...ferences Intakes stating that consumption of added sugars "displaces" essential vitamins and minerals in the diet. This "nutrient displacement hypothesis" is ...

Highlights of June Journal of the American Dietetic Association

...d vegetables and decreasing foods high in fats and sugars in moderation. Unhealthful weight-control behaviors were defined as skipping meals, fasting, using food substitutes and smoking. Among other findings, the researchers discovered: Girls using unhealthful weight-control behaviors had poorer overall d...

Insulin pump benefits preschoolers with diabetes

...insulin injection treatment. The children's blood sugars were measured and each child was given a special s...ensor for 72 hours that continuously tracked blood sugars to show how stable they were over time. Parents were asked about quality of life issues related to t...

HIV: A sugar shield to evade host defences

...de protection against the host's antibodies. These sugars are large structures that apparently block the way...sylation sites on the protein surface to which the sugars are bound. In this way a recent hypothetical model (3) envisaging the use by the virus of extremely ...

Sufficient evidence for reducing sugar intake to tackle obesity?

.../UN report to restrict consumption of free (added) sugars to counteract obesity and concludes: 'when conside...le evidence to suggest that sucrose and other free sugars contribute to the global epidemic of obesity'. In a joint report published in 2003, an expert...

Cord blood cells proven to differentiate into heart muscle and brain cells

...ing a critical enzyme needed to break down complex sugars in various cells. As sugar byproducts accumulate in vital organs such as the liver, heart and brain, cells become damaged and die. Duke physicians had observed that children with these rare metabolic diseases tended to regain organ function more rapi...

Major cause of painful gastroenteritis under study at MCG

...n those patients with certain strains is there are sugars on the outside of the bacterium that resemble sugars on peripheral nerve cells. So the body detects this infection, mounts an immune response against it ...

Salk news: Diabetes first steps

...hemical relay that controls whether the body burns sugars or fats for energy. Too much fat released from sto...wered remote control, insulin's ability to process sugars can wear down with repeated use. Eventually, it becomes progressively difficult for insulin to get s...

Comfort-food cravings may be body's attempt to put brake on chronic stress

...ious health consequences of a diet high in fat and sugars -- abdominal obesity (which can lead to cardiovascular disease, Type II diabetes and stroke), and cardiovascular disease itself. "In the short term, if you're chronically stressed it might be worth eating and sleeping a little more to calm down, perh...

What's in your child's lunchbox?

... ingredients first. "Fats, trans fats, salt, added sugars and high calories are found in many pre-packaged snacks. Choose healthier options that provide sustenance and not empty calories." The quantity of food packed is also important since portion size is another factor that contributes to overweight kids....

UCI biomedical engineer receives $1.8 million grant

...enny, and live on a specialized solution of salts, sugars and antibiotics. George's research team includes doctoral graduate students Justin Mih and Jinping Wan and staff research associate Julie Papp. Postdoctoral scholar Roel Bruels will join the team next month. The five-year grant comes from the Nation...

Morphine-like painkiller appears to be less addictive

...rst, they are easily degraded into amino acids and sugars in the body, which reduces their risk of toxicity. In addition, they are more specific in their action with the brain's receptors, which means fewer side effects. For now, researchers continue to work on reducing any possible side effects associated ...

Vitamins C and E may enhance effectiveness of insulin for diabetes

... called free radicals. The free radicals converted sugars and proteins into harmful chemicals, increasing th...h blood pressure somewhat and partially spared the sugars and proteins from the free radicals' assault. But it also added a new problem, as the free radicals ...

Bread crust and stuffing rich in healthy antioxidants

...amino acid L-lysine and starch as well as reducing sugars in the presence of heat. Chemists have long known that this same process, called a Maillard reaction, is responsible for producing the brown color associated with the surface of baked breads. The same reaction also produces flavor compounds and other...

1 2

(Date:7/25/2014)... (PRWEB) July 25, 2014 AttorneyOne.com, a recognized ... latest information from the FDA on Ibuprofen and Oxcarbazepine ... that one lot of Ibuprofen and one lot of Oxcarbazepine ... due to mislabeled packaging. Oxcarbazepine is used for the treatment ... , The reason for the recall is that Lot ...
(Date:7/25/2014)... July 25, 2014 Parker Waichman LLP, ... of consumers comments on a recent tobacco lawsuit in ... smoker $23.6 billion in punitive damages. Cynthia Robinson brought ... cigarettes. The case is Cynthia Robinson v. R.J. Reynolds ... Florida First Circuit Court, Escambia County, Florida; Case Number ...
(Date:7/25/2014)... Drexel University College of Medicine is pleased ... been appointed vice dean for education, effective October 1, 2014. ... Medical College, where she is currently chair of the Department ... of medicine. , As a member of the senior ... major role in many aspects of the development of the ...
(Date:7/25/2014)... vulnerable neurons and reduce motor deficits in a ... University School of Medicine have shown. , The ... Parkinson,s Disease . , The findings demonstrate that ... at sufficient levels and have beneficial effects when ... Previous studies of XPro1595 in animals tested more ...
(Date:7/25/2014)... 25, 2014 The new report ... Feed, Pharmaceuticals and Others), by Type (Amylases, Cellulases, ... Geography - Global Trends & Forecasts to 2019", ... of the global Carbohydrase market with analysis of ... is segmented and values are forecasted on the ...
Breaking Medicine News(10 mins):Health News:Ibuprofen and Oxcarbazepine Tablets Recalled: AttorneyOne Monitors and Keep Consumers Informed 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 3Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 2Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 3Health News:Anti-inflammatory drug can prevent neuron loss in Parkinson's model 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 3Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement