The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "supplements" at medical news

Chemoprevention backgrounder: Working for a future of cancer chemoprevention

...olon cancer. Previous work has suggested that both supplements could offer some protection, so "it makes sense to...ver undertaken - a study of selenium and vitamin E supplements in 32,400 men across the United States, Canada and Puerto Rico. Known as SELECT (the Selenium and Vi...

Pediatricians wary about recommending complementary therapies

...20 percent), special diets (17 percent) or dietary supplements (17 percent). Fewer than 5 percent asked about car... way to educate clinicians about herbs and dietary supplements using the Internet....

Women taking breast enhancement pills swallow empty promises

...mentation; however, these pills are sold as herbal supplements and are not subject to the U.S. Food and Drug Admi...ce. "The primary active ingredients found in these supplements can be dangerous when mixed with other medications. Because many women who want bigger breasts self...

Researchers show the BEST way to reduce osteoporosis risk

...to eat differently--they just took calcium citrate supplements to ensure adequate intake--and did the weight bear...ed in San Antonio, TX. Citracal calcium citrate supplements are sold in drugstores and pharmacies nationwide...

Hebrew University researcher finds 'sweet' way to help prevent heart disease

... and had undergone bypass surgery were given daily supplements of Sweetie juice for 30 days. The patients, who ranged in age from 43 to 71, were divided into three groups of 24 each. One group received a daily supplement of 100 milliliters of the juice; a second received 200 milliliters; and a third the control...

Some harms of beta-carotene supplementation may persist after discontinuing use

...s were stopped after evidence accumulated that the supplements were associated with an increased risk of lung can...r. In CARET, the group that received beta-carotene supplements had a 28% greater incidence of lung cancer and 17% more deaths from all causes compared with the pla...

New research tool aids study of national well-being

...construction of a national well-being account that supplements the measure of GNP with a measure of aggregate happiness is a revolutionary idea." Using the DRM method, the researchers asked 909 women to recall the previous workday as a sequence of episodes and rate the psychological and social aspects of ...

How are we doing? Researchers aim to measure national well being

...construction of a National Well-Being Account that supplements the measure of GNP with a measure of aggregate happiness is a revolutionary idea." The NIA is part of the National Institutes of Health (NIH) at the U.S. Department of Health and Human Services. In the DRM, participants revive memories of the prev...

Melatonin supplements offer little or no benefit for the sleep deprived - study says

...sive review of all studies on the use of melatonin supplements to treat sleep disorders. Some of the highlights of their findings include: melatonin supplements appear to have little benefit for jet lag sufferers or night shift workers the supplements do not a...

O Christmas tree: Your bark may fight arthritis

... trees that they say could be developed into food supplements or drugs for treating arthritis and pain. The comp... with arthritis may ease their pain by eating food supplements made from Christmas trees, says study leader Kalevi Pihlaja, Ph.D., a chemistry professor at the Uni...

Some herbal medicine products contain potentially toxic amounts of heavy metals

... require mandatory testing of all imported dietary supplements for toxic heavy metals," they conclude....

Scientists study fish oil diet in bid to cut heart attack risks

.... We intend to look at the action of both fish oil supplements and increased fish in the diet on the way the blood vessels of the body function. Heart attacks are caused by clots blocking inflamed arteries, so we will look at the effects of fish oils on inflammation and clot breakdown." The study, which is alrea...

Chamomile tea: New evidence supports health benefits

...t as a mild sedative, the scientists note. Glycine supplements are sold in stores for that purpose, they add. Levels of both hippurate and glycine remained elevated for up to two weeks after the study participants stopped drinking the tea, indicating that the compounds may remain active for quite some time, acco...

Jefferson scientists find zinc may help prevent esophageal, oral cancers

... there as well. These findings suggest that zinc supplements may prevent the development of esophageal or oral cancers, particularly in developing countries where zinc deficiency is a problem. The researchers reported their findings January 5, 2005 in the Journal of the National Cancer Institute.Zinc in the di...

Conference to examine effects of dietary supplements in patients taking blood thinning medications

...evaluate the risks of interactions between dietary supplements and prescription blood-thinning medications which ... systematic examinations of the effects of dietary supplements when taken with prescribed anti-thrombotic (anti-coagulant or anti-platelet) therapies. According to...

Complementary and alternative therapies and conventional medical therapies

...in particular the escalating popularity of dietary supplements as well as the lack of consistency and quality in ...sionals' abilities to guide patients on the use of supplements and researchers' ability to study them. The report calls on Congress to work with stakeholders to a...

Complementary & alternative medicine use

...adverse effects associated with individual dietary supplements as well as their interactions with prescription drugs". Despite variability seen in previously published reports about overall CAM use, the authors conclude the use of CAM by one third of U.S. adults from 1997 to 2002 appears to have been steady, re...

Institute of Medicine advisory: Jan. 12 Briefing on Complementary and Alternative Medicine

...herapies such as acupuncture, massage, and dietary supplements -- often in conjunction with conventional medical treatments. COMPLEMENTARY AND ALTERNATIVE MEDICINE IN THE UNITED STATES, new from the Institute of Medicine of the National Academies, looks at what patients and health care providers need to know abo...

Other highlights in the January 19 JNCI

...ited States, Puerto Rico, and Canada--will receive supplements of selenium, vitamin E, or both for 7 to 12 years. They will be encouraged to receive annual prostate cancer screenings but will be allowed to follow community screening standards and personal preferences. In a commentary, Scott M. Lippman, M.D., of ...

$10-million study explores men's role in transmitting HPV

...nclude cancer epidemiology biomarkers, nutritional supplements and diet in risk reduction, breast cancer and cancer screening. She left the University of Arizona to join Moffitt and USF in July 2004. ...

1 2 3 4 5 6 7 8 9 10

(Date:11/21/2008)...Newswire-USNewswire/ -- New research at West Virg... spitless tobacco product aimed at young adults is...RJ Reynolds, Camel Snus - touted as a socially acc...singly high levels of nicotine. , , "Camel ...products," said Bruce Adkins of the state Division...
(Date:11/21/2008)...swire-USNewswire/ -- U.S. News & World Report ...NCQA) ranked BlueChoice(R) HealthPlan of South Car...ans(TM), published in U.S. News & World Report...l ranking ranks the nation,s best health plans bas...QA accreditation scores. NCQA and U.S. News & ...
(Date:11/21/2008)...swire-FirstCall/ -- Barr Pharmaceuticals, Inc. (NY...overwhelmingly approved the proposals submitted to...Pharmaceuticals Industries Ltd. (Nasdaq: TEVA )....elming support of the transaction by the Barr shar...nd CEO. "We are pleased with the progress that we ...
(Date:11/21/2008)...y diseaseits cause remains a mysteryswept into Ath...citizens, soldiers and refugees of the war then ra...with corpses, social order broke down. Over the ne...ens lost a third of its population. It lost the wa...f the end of the Golden Age of Greece. , The Pl...
Breaking Medicine News(10 mins):Health News:Experts Say New Tobacco Product Targets Young Adults 2Health News:Experts Say New Tobacco Product Targets Young Adults 3Health News:BlueChoice HealthPlan Ranks in Top Third of America's Best Health Plans 2Health News:Barr Shareholders Approve Pending Teva Acquisition 2Health News:Barr Shareholders Approve Pending Teva Acquisition 3Health News:Barr Shareholders Approve Pending Teva Acquisition 4Health News:Study of ancient and modern plagues finds common features 2Health News:Study of ancient and modern plagues finds common features 3Health News:Study of ancient and modern plagues finds common features 4
Other Tagsalleviate 2alleviate 3alleviate 4alters 2alters 3alters 4alters 5alters 6alters 7orchestrates 2survived 2survived 3survived 4survived 5survived 6survived 7survived 8survived 9survived 10worsens 2smoke 2smoke 3smoke 4smoke 5smoke 6smoke 7smoke 8smoke 9smoke 10cigarette 2cigarette 3cigarette 4cigarette 5cigarette 6cigarette 7cigarette 8cigarette 9cigarette 10month 2month 3month 4month 5month 6month 7month 8month 9month 10rewarding 2
alleviatealtersorchestratesjudesnowballsurvivedsmearspapworsenssmokecigarettemonthyipsspellsrewardingmagnifies