Tag: "synthesize" at medical news

Scientists Produce New Anti-Malarial Compound

...lls 2 million people a year. Chemists were able to synthesize the new compounds after learninghow another, more expensive and difficult-to-produce malaria drugworks at the molecular level. The new compounds use the samemechanism to kill the parasite that causes malaria, but they aremuch less expensive and easie...

Fertilization Protein Structure To AID in Leukemia Treatment

... and rearranges their pattern of chemical bonds to synthesize the messenger. In leukemia, white blood cells have a signaling protein, called CD38, which in normal cells is only present in early stages of their development. Because a CD38 molecule has a remarkable similarity to the cyclase protein, Stou...

Area of Research Outlined For Promising New Cancer Drugs

...tin evidently interfere with the tumors'ability to synthesize new capillaries from pre-existing blood vessels, a processcalled angiogenesis. Essentially, the tumors were starved when the drugs wereadministered to cancer-bearing mice. Normally, only limited angiogenesis takes place in organisms after fe...

University Of Florida Researchers Hope To Ease Asthma Pains And Provide A Sigh Of Relief

... drug interactswiththe receptor in the cell and to synthesize new compounds in which theseinteractions are refined," said Nigel Richards, UF chemistry professor andmember of the research team. "If we can manipulate the structure of thedrug so as to control the motions of the receptor, we can change the shapeof ...

Improved Ritalin Offers Smaller Doses And Fewer Side Effects

...ates as anticocaine therapies." Being able to synthesize "chiral Ritalin" from inexpensive non-chiralstarting materials is the key to the drug's improvement, says Winkler. Drugcompounds generally have mirror images, known as being right and left handed,but often only one of the "hands" is biologically ac...

Research of Percy Julian , First Synthesis of Glaucoma Drug, Named National Historic Chemical Landmark

...AmericanChemical Society. The discovery of how to synthesize physostigmine established Julian's reputationas a world-renowned chemist at the age of 36 yet he was denied a facultypositionat DePauw because of his race. Frustrated in his efforts to gain an academicpost,Julian accepted an offer as director of res...

Patient Satisfaction And Decision Making Quality Greatly Improved During Improved Medical Consultations, UCSF Researchers Report

...ion, physicians have limited time and resources to synthesize a patient'sdetailed medical history, personal preferences and relevant medical information.As a result, breast cancer patients often leave medical consultations feelingconfused, frustrated and anxious about treatment decisions, says Laura Esserman,MD...

Raise eggs' vitamin D3 content sevenfold by adding more vitamin D to chicken feed

...y help preventpostmenopausal osteoporosis. People synthesize vitamin D in their skin with thehelp of sunlight, but inhabitants of northern countries, where sunlight can bescarce during much of the year, need to eat foods rich in vitamin D or takesupplements. Foods rich in vitamin D include fish, some wild mus...

How alcohol may harm your baby's brain

...rons called Purkinje cells, which act to filterand synthesize information leaving the cerebellum for other brain regions. Asreported in the October issue of Alcoholism: Clinical & Experimental Research,Purkinje cells need a trophic (growth-enhancing) factor called Glial DerivedNeurotrophic Factor (GDNF) to su...

New light on the role of microbial pathogens in atherosclerosis

...% produceintermediate levels and 5 to 10% can only synthesize small amounts. The Inserm team worked on a mouse strain deficient in IL-10. The animals wereraised in cages with filtered air (protecting them from air-borne microbes), andreceived a diet designed to induce atheroma plaque. The researchers found tha...

Scientists identify new pathway of antidepressant action

...h strengthens the likelihood that the enzymes that synthesize neurosteroids can make prime targets for mood-regulating drugs. "We're interested in finding compounds that may directly affect these enzymes in the brain, and thus regulate mood disorders with minimal side effects," she said. The research was suppor...

Chemist Percy Julian captures spirit of black history celebration scientist

... and gas fires. In 1948, he developed a new way to synthesize the hydrocortisone used to treat rheumatoid arthritis - the method most widely used to this day. By the time he died in 1975, his research had resulted in more than 160 separate patents. As one of his tributes, the U.S. Postal Service recognized hi...

Not Cartier, but non-allergenic and long-lasting: Worlds first diamond micromachines created at Sandia

...l because of the far higher temperatures needed to synthesize it and the surface roughness that precludes its use in a multilayer surface micromachine technology. Amorphous diamond itself had been impractical because its tremendous internal stresses -- hundreds of atmospheres -- formerly had made it impossibl...

Harvard researcher receives national award

... antibiotic of last resort. They were the first to synthesize the bacterium-derived antibiotic in the laboratory. "We're also collaborating to reveal the details through which nature builds vancomycin," he said. "We hope to improve and modify the biosynthesis to build vancomycin analogs," which may be more po...

Irvine researcher receives national award

...s have used his fundamental insights to design and synthesize drugs. "Proteins in the body are very precise machines," he explained. "Most proteins are rapidly turned over, but others like collagen and elastin in the skin and lens proteins in the eye are around for decades. They accumulate damage over time -ski...

American award recognizes Swiss researchers

...chemist with Novartis Pharma AG. "So we decided to synthesize it in the laboratory in sufficient amounts and set up our own studies." That project, begun in 1974, culminated five years later with the synthesis of octreotide, a growth-hormone inhibitor. Novartis markets the drug as Sandostatin. "When you try to ...

Process may help scientists find new antibacterial drugs

...others like him have been developing techniques to synthesize batches of chiral compounds that consist solely of one enantiomer. Such synthesis techniques can aid efforts to design and use new compounds by making it easier for scientists to put the compounds to use without the confounding effects that two enant...

UIC chemists synthesize potent anticancer compound

...g were racing as many as 10 top teams worldwide to synthesize the molecule, whose structure contains a 20-membered ring and nine asymmetric carbon atoms whose "handedness," or stereochemistry must be maintained. "Building a molecule in a flask with all the bonds and specific configurations found in nature is a...

North Carolina researcher receives award for new ant-HIV drug that simplifies treatment regime

...proved effective in 1995, a way had to be found to synthesize it on a large enough scale to make it available to patients. Daluge came up with an approach the U.S. Food and Drug Administration approved in late 1998. Through its industrial innovation awards program, the American Chemical Society recognizes indi...

Stony Brook chemist wins national award for drug discoveries

...t for the spotted owl. Ojima developed a method to synthesize taxol in the laboratory and is now working on second-generation drugs called taxoids. "We'd immediately recognized that taxol has many terrible side effects," including neurotoxicity and bone marrow and cardiac damage, he explained. "Drug resistanc...

1 2 3

(Date:6/19/2013)... DiscountFurnaceFilter.com, the number one solution for homeowner’s ... Compressor Saver kit at an exceptional price. The 5-2-1 Compressor ... air conditioning unit during start up, saving wear and tear ... unit burn out. , The 5-2-1 Compressor Saver ... uses less power to start and drastically reduces the rush ...
(Date:6/19/2013)... 19, 2013 Kansas City will host its first ... Street Day . A section of Main Street in the midtown ... afternoon of the event. The Main Street Corridor Development ... will help Kansas City join the ranks of dozens of cities ... tool to foster community vibrancy and active lifestyles. , “Ciclovia is ...
(Date:6/19/2013)... June 19, 2013 In 2011, the ... EUR 710 million. Generic drugs form the largest sector, ... value. The pharmaceutical industry is a significant contributor to ... the country’s GDP. Approximately 50% of the total domestic ... pharmaceutical industry. Hemofarm, Galenika and Zdravlje Actavis are key ...
(Date:6/19/2013)... Elsevier, a world-leading provider of scientific, technical ... the publication of the National Osteoporosis Guideline Group ... osteoporosis in postmenopausal women and older men in ... 2009 in Maturitas , the original guidelines ... timely with an additional focus on the management ...
(Date:6/19/2013)... Next Thursday, June 27, 2013, ... organization, and Muzzy Lane Software , a ... the Games for Health community to their interactive ... toward students in grades 4-7 and designed to ... positive choices. The game is part of a ...
Breaking Medicine News(10 mins):Health News:Main Street Corridor Development Corporation and BikeWalkKC Partner to Host Main Street Day and Kansas City’s First Ciclovia 2Health News:Main Street Corridor Development Corporation and BikeWalkKC Partner to Host Main Street Day and Kansas City’s First Ciclovia 3Health News:Serbian Pharmaceutical Market Scrutinized by CUBE in Topical Report Now Available at MarketPublishers.com 2Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 2Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 3Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 4Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 5
Other Tags
nevadaclocksfitnesskeepsprimevalantiangiogenichorizonsubmitapheresisrenownedareprioritiescortexgambiaopposeshivmaputs