Tag: "the" at medical news

Drug And Radiation Treatment May Shrink Pancreatic And Gastric Tumors

...reducing locally advanced and inoperable tumors in the pancreas andstomach. The finding may be an import...eatments for these cancers currentlyexist. Indeed, the five-year survival rate for patients with pancreatic canceris less than five percent. The treatmen...

Laser Shown Effective In Patients Who Are Not Candidates For Bypass Surgery Or Angioplasty

...other conventional forms of treatment,according to the results of a recently completed multi-center clini... A study of 198 patients, randomized to either the new laser therapyor continued treatment with heart medicines, found that 71 percent of thepatients t...

Study Shows Gum Disease Increases Risk Of Future Heart Disease

...se are at high risk of developing heart disease in the future, particularly if they also are diabetic, researchers in the University at Buffalo School of Dental Medicine have found. Results of the study, conducted amo...

Routine Dental X-ray May Be A Valuable Tool In Stroke Prevention

ORLANDO, FLA. -- The dentist's office may become the new first line of defense in the battle to prevent stroke. Dental researchers in the University at Buffalo School of Dental Me...

ACTG Protocol 185 Enrollment Halted

... rate of infant infection which made comparison of the standard and experimental treatments impossible. ...cted pregnant women to their infants when added to the standard AZT-based preventive treatment regimen. The comparison group received AZT and standard int...

Common Carbohydrates May Prove To Be Substitute For Dietary Fiber

CHAMPAIGN, Ill. -- What if a person could get the benefits of dietaryfiber without eating bowlsful o... a professor of animal sciencesand of nutrition at the University of Illinois. "Oligosaccharides may prove to be a replacement for part of thedietary fibe...

Duke Study Uses Tiny Temperature Changes To Probe Water-Exclusion At Protein Binding Sites

...a Duke University bioorganic chemist is exploiting the differences betweentwo forms of water to probe how proteins' shapes control the way they bindwith other molecules. Such binding reactions, which occur constantly in watery so...

MRI-Guided Cancer Surgery

...e that has brought magnetic resonance imaging into the operating room. Hines, mayor of North Cant...conducted at Case Western Reserve University under the direction of Jonathan Lewin, M.D. It is a safety and feasibility study focusing on patients with is...

Laser Offers Hope For Heart Patients With No Alternatives

... conventional forms of treatment. Duke is the only medical center in the Southeast using the laser system,which has demonstrated promising results for the eight patients tre...

UNC-CH Study Shows State Protects HMO Clients Poorly

...APEL HILL, N.C. -- North Carolina fails to protect the interests of state residents enrolled in health ma...tions nearly as well as it should, chiefly because the organizations have grown so fast that laws and regulations have not kept up, according to a new Univ...

Kids Near Airports Don't Read As Well

...covered one major reason: kids tune out speech in the racket. "We've known for a long time that chronic noise is having a devastating effect on the academic performance of children in noisy homes and schools," says Gary Evans, an international expe...

Researchers Gain Insights Into Drugs Used For Manic-Depression

...to a two-drug combination treatment.Researchers at the University of Wisconsin Medical School now believe theyunderstand why. In the current Proceedings of the National Academy of Sciences, thescientists show that both drugs stimulat...

Guidelines Offer Ways To Curb Antibiotic-Resistant Infections

...ast in hospitals and health care facilities across the nation, University of North Carolina at Chapel Hil..., up from about 2 percent in 1975. Responding to the growing health concern, the N.C. Statewide Infection Control Program at the UNC-CH School of Medicin...

Substance from Grapefruit Juice May Make Medications Safer

...ass of grapefruit juice can significantly increase the absorption of a number of commonly used oral medic...rotease inhibitors (used to treat AIDS). Although the "grapefruit juice effect" was discovered serendipitously almost a decade ago when scientists gave vo...

The Condom Conundrum--How Are We Going To Teach Safe Behavior If Parents Are Afraid To Talk To Their Children About Sex?

...eir teenagers about sex, health and condoms, mum's the word for most American parents. "The core of the problem is that it is harder for adults to talk about sex than substance abuse. Parents don't talk a...

Learning From Experience: New Pattern Recognition & Detection Helps Radiologists Analyze Digital Mammograms

...ion systems, this approach does nottotally rely on the intervention of a human to extract and define a se...ier to look just for those features, we would have the expertuser, in this case, the radiologist, directly build a database of knowncancer indications enco...

Antimicrobial "Bug Spray" Found In Human Lung Cells

...p fight lung infections in both CF patients and in the general population, where infectious lung diseases...eople every year. "People have always thought that the lungs only attacked infections via the classical immune system--B cells, T cells and other immune ce...

Study Injects New Interest In How Vaccines Work

...out how a major component of vaccines works within the body has been shot down by a Purdue University stu...xide, a small particle used to carry antigens into the body to boost an immune response, begins to dissolve in the muscle immediately after an injection an...

New Drug For Parkinson's Disease Proves Effective, Study Finds

... fewer side effects thansimilar drugs currently on the market. Patients treated withpramipexole dihydrochloride see an average 20-percent reduction in the severity of their symptoms, according to the first large-scale study of the drug's effects on patien...

Milk Extract May Heal Wounds And Smooth Wrinkles

...Cleopatra might have been right all along -some of the chemicals found in milk could be very good for your skin. Theymay even speed up the healing of wounds. The scientists are not suggesting people should follow the ancient Egyptianqueen...

1 2 3 4 5 6 7 8 9 10

(Date:5/19/2013)... York, New York (PRWEB) May 19, 2013 ... that a Case Management Conference was recently convened for ... a federal multidistrict litigation now underway in U.S. District ... posted on the Court’s website on May 14th, the ... It was also reported during the Conference that ...
(Date:5/19/2013)... 2013 The Fat Loss Code program developed ... that help people get in shape, and gain a ... The program also is a natural fat loss system that ... author of this fat loss diet program claimed that The ... help people keep body fat off long-term. After Shawn Stevenson ...
(Date:5/19/2013)... Exciting new Skin Brushes are available ... great practice known through the ages but is a ... body brushing, has so many benefits for our health ... "We love that circulation and lymphatic systems get a ... skin, is supported through Skin Brushing." , Why is ...
(Date:5/19/2013)... 2013 The AMTC team will be screening ... Georgia Convention & Trade Center on June 1st. Professionals and ... auditions are free of charge. , Actors, Models and Talent ... of successful artists and grads like Caitlin Kinney - SYTYCD, ... , Chris Young - on his Liquid Neon 2013 Tour, ...
(Date:5/19/2013)... OH (PRWEB) May 19, 2013 The ... continue to follow developments in the nation’s first trial ... case, underway in Washington State Superior Court, was filed ... years after he suffered complications in a robot-assisted prostate ... The Da Vinci robotic surgery lawsuit alleges ...
Breaking Medicine News(10 mins):Health News:Pradaxa Lawyers at Bernstein Liebhard LLP Report on Recent Status Conference in Federal Pradaxa Litigation 2Health News:Pradaxa Lawyers at Bernstein Liebhard LLP Report on Recent Status Conference in Federal Pradaxa Litigation 3Health News:Weight Loss Secrets | How “The Fat Loss Code” Helps People Gain A Healthy Life And Get In Shape - Health Review 2Health News:Exciting New Skin Brushes at Sublime Beauty® Bring Health and Beauty Benefits; Celebrities and Models Know the Secret 2Health News:Actors, Models and Talent for Christ Hosting Auditions in Columbus, GA June 1st in Search of Local Talent 2Health News:Da Vinci Surgical Robot Lawyers at Wright & Schulte LLC Note Recent Developments in Da Vinci Robot Lawsuit Trial 2Health News:Da Vinci Surgical Robot Lawyers at Wright & Schulte LLC Note Recent Developments in Da Vinci Robot Lawsuit Trial 3Health News:Da Vinci Surgical Robot Lawyers at Wright & Schulte LLC Note Recent Developments in Da Vinci Robot Lawsuit Trial 4
Other Tags
manageradoptionhysteriagrapplingbrewsphysicistsmillipedescavemassesremovingcompletelyappropriatewiperelativelycursorsmalarial