Tag: "toxic" at medical news

Duke Doctors Can Now Cure Most Babies Born With Fatal Immune Disease

...many, Buckley said. First, the infantis spared the toxic "anti-rejection" drugs normally given to suppress ...e transplants.Our approach avoids chemotherapeutic toxic agents and all their complications,"said Buckley. Buckley aids the recovery of her patients ...

Interleukin-2 Boosts Cancer Vaccine Effectiveness In Mice

...ccine is important, Mulé added, because the toxic effects of high-doseIL-2 therapy have limited its effectiveness against cancer in the past. "Dosages of IL-2 used in our study were 25 to 50 times lower than the maximumtolerated dosage," Mulé said. "They were comparable to the low dosages us...

Breakthrough? Study Finds Dopamine Cannot Be Source Of Pleasure In Brain

...in, Wightman said.It also might help identify less toxic substances that could ease withdrawal andmake it more successful. "Because nobody ever had a way of making these kinds of measurements, wethink this is really a big jump ahead," he said. "Often it is new technologythat in fact drives new find...

Intravenous Immunoglobulin Reduces Steroid Insensitivity, Hospitalizations Of People With Severe Asthma, According To National Jewish Research

...w side effects. "Compared to steroids, IVIG isnot toxic at all," Dr. Gelfand said. "In addition, lowering the amount ofsteroids a patient takes reduces side effects and the patient's quality of lifeimproves dramatically." IVIG treatments cost several thousand dollars each month for people withsevere asth...

UW-Madison Center One Of Two Sites Nationwide Selected For Clinical Trial Of Cancer Drug

...ses of the drug and willbe carefully monitored for toxic effects. Additional patients will then receivegraduated doses of the drug. All patients will be carefully monitored through avariety of complex tests. "The research team will recruit patients with solid tumors that have failed torespond to treatment...

Penn Researchers Find Chemoembolization Effective For Liver Tumors

...ids exposing the rest of the bodyto chemotherapy's toxic effects," explains Dr. Soulen. "Thistechnique is not a cure, but it can extend patients' lives andpreserve their quality of life." In this study, 51 patients whose colon cancer had metastasized tothe liver were treated with chemoembolization. Eighty-...

International Meeting To Reduce Neonatal Mortaltiy

...s(pneumonia and diarrhea), malaria and exposure to toxic substances. An international meeting funded by USAID's Child Health Research Project andhosted by the Johns Hopkins School of Public Health, May 10-12, 1999 willsystematically examine the extent and causes of the problem of perinatal andneonatal mort...

Progress In Cancer-Vaccine Studies: Simpler, Safer Approach Producing Encouraging Results

...e, tiredness and mild fever.Higher doses were more toxic and much less effective. In addition to generating few side effects at low-to-moderate doses, the regimenwas unusually effective. Fifteen patients were enrolled, all with advancedmelanoma. Fourteen had previously gotten worse despite prior treatments...

Sniffing Out The Promise Of Anti-Angiogenesis Therapy

...ect,says Gill, "NK cells produce factors which are toxic to endothelial cells," heexplains. Endothelial cells are the cells out of which blood vessels aremade-and from which KS develops. But IM862's effect on blood vessel formation reaches even further. Gill and hiscolleagues found that when chicken allant...

UI Researchers Identify Possible Reason For Rare, Accelerated Aging Condition

...s it impossiblefor the cells to effectively remove toxic peroxides produced during normal cellmetabolism. Reintroducing antioxidant enzymes into the cells may halt or reverse theproblem. To accomplish this, the UI investigators plan to use adenovirus genetransfers. This approach involves attaching the enzy...

Less Toxic Bone Marrow Transplant Technique May Have More Powerful Anti-Cancer Effect

...ing their transplants. Sykes notes that this less toxic approach to bone marrow transplantation mayopen the technique up to individuals - particularly the elderly - who could notwithstand the harsh conventional regimens. Follow-up studies are investigatingthe additional anti-cancer effect of a post-trans...

Climate change will have detrimental effects on health in Europe

...er purification and sewage disposal systems; cause toxic waste sites to overflow and dislodge chemicals stored in the ground. There may also be an increased risk of communicable diseases after flooding, they warn. Malaria, visceral leishmaniasis, tick borne encephalitis and Lyme disease are all vector bo...

Novel drug therapy tackles third 'pathway' causing congestive heart failure

...n says TNF may worsen heart failure because of its toxic effects on the heartand circulatory system. "TNF levels are seven to eight times higher in peoplewith congestive heart failure than in those with normal hearts," he says. "Since in laboratory animals TNF alone can produce many of the symptoms ofcon...

Vaccine against Hepatitis A protects kids and families now; Hepatitis B vaccine protects kids as they become adults

...ch diverse events as viral infections, exposure to toxic chemicals orlong-term alcohol abuse. Hepatitis B is caused by a specific virus. Type A,caused by a different virus, does not lead to the degenerative liver diseaseassociated with hepatitis B, but it can cause sudden, violent illness thatquickly sprea...

Losing hostility makes heart patients healthier

... "But hostility may bethe Type A character's most toxic component." Twenty-two men who were coronary heart disease patients that scored high onhostility tests were split into two groups, a control group and an interventiongroup. The results of the study appear in the current issue of HealthPsychology. Me...

Anti-diabetic drug found to dramatically reduce symptoms of bowel disease that affects millions worldwide

...steroidsand other immune modulatory agents, can be toxic to the human system. "Becauseof this, we've been searching for more effective, safer oral treatments forulcerative colitis," says Wu. Using cell cultures, the researchers are also discovering how TZDs work on amolecular basis. By binding to PPAR-g...

Symposium on treating drug addiction -- Tip sheet

...that, when injected in large quantities, reducethe toxic effects of cocaine overdose. ( Kim D. Janda, Ph.D., The ScrippsResearch Institute, La Jolla. MEDI 158, 11:15)...

Progress toward a vaccine to fight cocaine addiction is reported

...ich, when injected in largequantities, reduces the toxic effects of cocaine overdose. Janda said animal studies are in the final stages of completion and humanclinical trials should begin by the end of the year....

Double transplant frees patient from need for immunosuppressive drugs

...e described in the current report uses a new, less toxic preparationfor bone marrow transplant that was developed at the MGH Transplantation BiologyResearch Center (TBRC). As described in the May 22 issue of The Lancet,patients are prepared for the transplant with a combination of mild chemotherapyand ant...

Selective and nonselective beta-blockers equally effective in preventing sudden death

...rt. The receptor inhibition by the drug blocks the toxic effects of thesympathetic nervous system on the heart. Both the selective and nonselectivebeta-blockers used in this study appeared to alter ventricular function of theheart. The other researchers involved in this study were UT Southwesternme...

1 2 3 4 5 6 7 8 9 10

(Date:6/19/2013)... Ultimate Medical Academy (UMA) participated in the 30th ... News Channel 8. Since its inaugural televising in 1984, ... All Children's Hospital in St. Petersburg, Fla. , The ... marked the second year UMA volunteered for All Children's. ... during the Telethon, which raised a substantial $4.2 million ...
(Date:6/19/2013)... Imprivata ®, a leading global provider ... Imprivata OneSign ® leads the single sign-on (SSO) category ... & Services report . CIOs and other healthcare executives ... performance of its products and the quality of its ... is integral to their long-term healthcare IT strategy. ...
(Date:6/19/2013)... HI (PRWEB) June 19, 2013 ... company is dedicated to being an effective and cost ... reception needs. They have partnered up with Tom Barefoot’s ... and discounts on most of Hawaii’s activities. , They ... how clients can get the lowest prices on their ...
(Date:6/19/2013)... 19, 2013 The producers of Viewpoints ... Phoenix, Arizona. The city is located in the center ... has shed its frontier image and become an affordable city ... the fifth-largest city in the United States with a workforce ... offers residents a low cost-of-living, friendly business environment and more ...
(Date:6/19/2013)... MAYWOOD, Il. A Loyola University Chicago Niehoff School ... grant to study whether Vitamin D can improve mood ... study also will examine whether vitamin D supplementation can ... their diabetes. The grant is from the National Institute ... , Principal investigator Sue M. Penckofer, PhD, RN and ...
Breaking Medicine News(10 mins):Health News:Ultimate Medical Academy Rallies in Support of All Children's Hospital 2Health News:Ultimate Medical Academy Rallies in Support of All Children's Hospital 3Health News:Imprivata Tops Single Sign-On Category in KLAS 2013 Mid-Term Performance Review 2Health News:Imprivata Tops Single Sign-On Category in KLAS 2013 Mid-Term Performance Review 3Health News:Maui'd Forever Pleased to Offer Price Guarantee on Hawaii Activities 2Health News:Viewpoints TV Announces June Air Dates for Phoenix, AZ 2Health News:Loyola receives $1.5 million grant to study vitamin D for diabetes and depression 2
Other Tags
capillarymaterialisemisshapentacticsoupamchitkapassivelawnsstaraffirmsmelodyunbornregretbeverageassurefao