Tag: "toxic" at medical news

Zebrafish: Drug discovery of a different stripe holds promise in COX research

...earching for gene mutations induced by exposure to toxic chemicals, which coincide with abnormalities of development. Such an approach is termed "forward genetics." The Penn paper, detailed in this week's print edition of the Proceedings of the National Academy of Sciences, is an early example of the use ...

Buck researcher makes progress in fight against Huntington's Disease

...ns or indirectly by cleaving proteins into smaller toxic fragments that threaten the survival of neurons. "..., such as cleavage of healthy proteins into small, toxic fragments that interrupt normal brain function....

Mad hatters, seafood jubilees, & Pfiesteria Files

... "The Pfiesteria Files," a one-hour documentary on toxic bloom episodes in the Chesapeake Bay won two major film prizes this week. An Emmy for Best Documentary was awarded by the Washington regional chapter of the National Academy of Television Arts and Sciences, and a first place ECO Award will be announ...

Newer lung cancer treatments extend survival longer than traditional regimens

...ng that the three-drug regimens were slightly more toxic and did not appear to provide any additional benefits. Patients on the three-drug regimens required more hospitalizations for fever and neutropenia, and experienced more toxicity due to myelosuppression....

New gene therapy protocol: First successful treatment for 'bubble babies'

...ocytes in the blood had risen dramatically and the toxic products in the blood, which would normally kill the lymphocytes, had declined. Within a month, Salsabil was out of isolation and went home in perfect condition, with no medications. Nearly two years after the gene therapy, all her T cells and B cel...

Hypertension is study focus of $10 million NIH grant to MCG

...ses superoxides, a type of free radical, which is toxic to cells, Dr. Jennifer Pollock said. Superoxides and other free radicals are often found in the body, but the body has defense mechanisms to overcome them. The Pollocks theorize that in their animal model, Dahl salt-sensitive rats, as well as people...

Vaccination delays onset of prion brain disease in mice

... for the prion protein, which could potentially be toxic if used in humans, explains Einar Sigurdsson, Ph.D., Assistant Professor of Psychiatry and Pathology, an author of the paper. "We are currently making alterations in the prion protein to reduce the likelihood of toxicity while maintaining a therapeut...

Northwestern researcher calls for simplified, less toxic HIV therapies

...and clinicians to develop more simplified and less toxic strategies to insure patient compliance and quality of life without sacrificing the potency of a protease inhibitor-containing regimen. The current standard of care for HIV includes complicated protease inhibitor-based combination therapies with la...

Bladder-sparing procedure found effective for treating invasive bladder cancer

...better drugs that are both more effective and less toxic to the patient" Shipley adds that the new treatment strategy is gaining acceptance "As an alternative to radical surgery, it's now being offered to more patients, although it's not yet as common as are lumpectomies for breast cancer."...

Better control of liver enzymes saves lives of HIV patients, says University Of Pittsburgh

...viral hepatitis or alcohol abuse, all of which are toxic to liver cells. Liver failure is the most common cause of death in people with AIDS. While ALT and AST testing is routine in monitoring of HIV patients, elevations are not typically addressed unless they are more than twice what is considered normal....

Drug developed at Duke appears effective in treating respiratory failure in newborns

...t it does so very inefficiently and in the process toxic free radicals are produced, Stamler said, adding t...am was to find an agent that would not produce the toxic free radicals and could replete SNO. Additionally, any potential drug would have to be able to be tr...

Gene therapy boosts cancer chemotherapy

...and disrupt their blood supply, but it can be very toxic when given systemically. The researchers originally altered the TNF gene so that it could be turned on by radiation therapy. Now they have produced a version of the gene that can be activated by exposure to the common anti-cancer drug cisplatin. S...

Colorectal cancer drug provides important option for patients with advanced disease

...till being evaluated. Oxaliplatin can have a toxic effect on the nerve endings that may result in an acute or cumulative pattern of side effects, most often numbness or tingling in the hands, feet, mouth or throat. Other side effects may include nausea, diarrhea, anemia, increased risk of bleeding or...

Boston chemist wins national award for tailor-made molecules

...keted as Alleve) reduces pain; its mirror image is toxic to the liver and thus cannot be included in the drug. Panek and his research team have discovered a process that leads to an almost pure form of "handed" tetrahydropyridine, a component found in many drugs -- HIV protease inhibitors and blood thinnin...

Pennsylvania chemist wins national award for pharmaceutical research

...keted as Alleve) reduces pain; its mirror image is toxic to the liver and thus cannot be included in the drug. Zhang has discovered ways to use small catalysts -- chemistry's construction workers -- to assemble one mirror image over the other. His catalysts use atoms of precious metals such as gold or plat...

Studies define biochemical structure that keeps blood pressure low, bypass grafts open

...grab it and either inactivate it or turn it into a toxic compound." And there's the rub. When sufficient nitric oxide isn't available to activate sGC, the unhealthy result can be production of one of the most potent self-made toxins in the body and resulting hypertension, heart and kidney disease and erec...

Marijuana-derived compound targets pain, inflammation

...n most applications primarily because of a lack of toxic side effects," says Sumner Burstein, Ph.D., lead investigator in the study and a professor in the department of biochemistry and molecular pharmacology at the University of Massachusetts Medical School in Worcester. "The indications so far are that ...

Combined kidney and bone marrow transplantation allows patients to discontinue anti-rejection drugs

...he kidney failure made them unable to tolerate the toxic aspects of standard bone marrow transplantation, w... MGH Bone Marrow Transplant Unit, developed a less toxic bone marrow transplantation protocol in which the recipient's immune system is only suppressed inste...

New anti-inflammatory drug clears Alzheimer's provoking protein from brains of mice

...r's disease -- before amyloid deposits harden into toxic plaques, Dr. Gordon said. "It points to the possibility that some microglial activation, or inflammation, might be considered beneficial. However, it is still likely that excessive activation will be detrimental." Future experiments will examine the...

Data shows life of kidney transplant lengthened by CellCept

...ble to reverse some of the cyclosporine-associated toxic effects and halt the progression of the damage to ...apy. CellCept provides patients with a non-kidney toxic treatment which not only has the ability to prevent them from rejecting their organ, but also retain...

1 2 3 4 5 6 7 8 9 10

(Date:5/21/2013)... 2013 Spring is the perfect time ... markets filled with whole foods to weather perfect for ... the season the nutrition experts at Brilliant Nutrition highlight ... miss. , 1. Eating Locally, With the abundance of ... linger and explore, spring is a great time to ...
(Date:5/21/2013)... George Washington (GW) University School of Public ... launch of the Avance Center for the ... SPHHS, the Maryland Multicultural Youth Centers, the ... university-community partnership aims to address public health ... research, mutual capacity building and prevention efforts. ...
(Date:5/21/2013)... Parker Waichman LLP, a national law firm dedicated ... devices, is offering remarks on the closing argument of the ... E. Taylor v. Intuitive Surgical, 09-2-03136-5, Superior Court, State of ... Bloomberg report noted that the plaintiff’s attorney, after noting ... how it deployed its strategy to train doctors to use ...
(Date:5/21/2013)... Charlotte, NC (PRWEB) May 21, 2013 ... Greater Charlotte will hold a free Community Wellness Fair ... screenings. The fair will be held on Wednesday, May ... University City YMCA (8100 Old Mallard Creek Road, ... American Heart Association and the Mecklenburg County ...
(Date:5/21/2013)... 21, 2013 Arizona State University ... want to develop their ideas into solutions, products ... , The university is recruiting participants for AREA48 ... space” that provides early-stage entrepreneurs with opportunities to ... open to anyone, ASU is particularly seeking participation ...
Breaking Medicine News(10 mins):Health News:Brilliant Nutrition Offers 5 Ways to Live Healthier and Inspired this Spring 2Health News:Brilliant Nutrition Offers 5 Ways to Live Healthier and Inspired this Spring 3Health News:GW launches center to address health disparities in the Latino immigrant community 2Health News:GW launches center to address health disparities in the Latino immigrant community 3Health News:Da Vinci Robotic Surgery Lawsuit: Parker Waichman LLP Reacts to Plaintiff’s Attorney’s Closing Argument in Which He Describes Intuitive Surgical as a Car Dealership 2Health News:Da Vinci Robotic Surgery Lawsuit: Parker Waichman LLP Reacts to Plaintiff’s Attorney’s Closing Argument in Which He Describes Intuitive Surgical as a Car Dealership 3Health News:Mecklenburg EMS Agency Teams Up with the YMCA of Greater Charlotte and Others to Educate the Public on Health Related Initiatives 2Health News:ASU Launches Summer Program for Aspiring Entrepreneurs, Innovators and Inventors 2Health News:ASU Launches Summer Program for Aspiring Entrepreneurs, Innovators and Inventors 3Health News:ASU Launches Summer Program for Aspiring Entrepreneurs, Innovators and Inventors 4
Other Tags
confidentialitydisorderspsychiatricfindingtakecampaignsmediaasmsubarachnoidfetusesantherosclerosisathleticismzincinsertssalediscourages