Tag: "transmit" at medical news

Satellite technology to climb Everest

...hundred people. The March Networks technology will transmit blood oxygen levels (SpO2), heart rates, blood pressure and body temperatures of the climbers. The recorded data will be stored on Bluetooth-enabled PDA's and ultimately transmitted via satellite to a Canadian-hosted website. The light-weight, porta...

Sounds of New York, evidence for a preferred ear, ultrasound for the eye

...Researchers have developed the stunning ability to transmit sound from a single point to multiple locations simultaneously-with each receiver getting potentially different messages. Session 2aSPa will feature various experimental demonstrations of this technique. For example, Heechun Song of the Marine Phys...

Substance use, social stress compromise pregnant women's immune system

...ers called cytokines small protein molecules that transmit signals within the immune system are an early risk factor for premature birth and infant lung and brain injuries. Screening pregnant women for high cytokine levels and stressful social factors such as family violence, poverty or substance abuse coul...

Handwashing program decreases incidence of diarrhea among children in Pakistan

...may cause diarrhea from hands that might otherwise transmit these pathogens to vulnerable infants. "Although visiting households weekly to provide free soap and encourage handwashing was effective in reducing diarrhea, this approach is prohibitively expensive for widespread implementation. The next essential...

Climate-based model to predict West Nile virus activity

... influence of climate on mosquito populations that transmit diseases such as West Nile virus (WNV) to humans. Funded by a $495,000 Global Programs grant from the National Oceanic and Atmospheric Administration (NOAA), the three-year project is a collaborative effort involving medical entomologists, climatolog...

New understanding of neural circuits may help development of thought-controlled prosthetic devices

...of nerve cells in the brain constantly compute and transmit complex signals through the spinal cord and out peripheral nerves in order to move an arm, hand, leg, or foot. An injury that causes the loss of a limb or damage to the spinal cord can sever this communication line and prevent desired movement. In th...

Several new techniques show promise for spinal cord repair

...oughout life and send new axons-or nerve fibers-to transmit smell sensations to the brain. Scientists have long thought that OECs assist the normal regeneration of these axons and guide them into the brain where they make new functional connections. Because axons lose myelin after a trauma such as spinal cord...

Rice engineers demo first T-ray endoscope

...T-wave energy very quickly, and fiber optics don't transmit T-waves. By blending some aspects of both these technologies, Mittleman's team devised a system to guide T-waves in and out of a confined space. This could prove useful for sensing applications that range from the mundane -- scanning packages of cook...

Novel imaging technique shows abnormal brain anatomy in children with ADHD

...found differences in the brain fiber pathways that transmit and receive information among brain areas. "Typically ADHD is described as a chemical imbalance, but our research has shown that there may also be subtle anatomical differences in areas of the brain that are important in this disorder," said co-prin...

Broad-based vaccination of wild mice could help reduce lyme disease risk in humans

...d Lyme disease, and, more specifically, which ones transmit the more virulent strains, needs further study, the researchers contend, to determine how best to implement a broad-based vaccination program. Also, study sites need to be monitored for strains that are not susceptible to the vaccine. Lastly, experim...

Wisconsin scientists grow critical nerve cells

...damaged or diseased nervous systems. Motor neurons transmit messages from the brain and spinal cord, dictating... activity, a sign that the neurons, which normally transmit electrical impulses, were functional. The spinal motor neuron cells have survived in culture in the ...

Association publishes blueprint to strengthen stroke care from prevention through recovery

...speed videoconferencing and imaging links that can transmit interactive clinical and brain scan data directly to physician's office. Because many who experience a stroke will be unable to call for help on their own, prevention includes community education programs to increase stroke systems and help the publ...

HIV-infected parents report limiting physical contact with their children

...cted by the disease. Because HIV patients can both transmit the virus and may be vulnerable to opportunistic infections (occurring in people with weakened immune systems), a fear of infection may affect parent-child interactions. Mark A. Schuster, M.D., Ph.D., from RAND Corporation, Santa Monica, Calif., a...

Routine HIV screening should be expanded, study finds

...he rate at which those infected with the virus can transmit the disease to others. HAART therapy involves using multiple drugs, all of which block replication of HIV genes. For most patients, these drugs combinations have reduced the viral load in the blood to virtually undetectable levels. Not only has this ...

Schepens scientists regenerate optic nerve for the first time

...of millions of nerve cells, which, when uninjured, transmit visual information from the retina to the brain for interpretation In earlier research, Chen's team discovered several processes that they believed "locked up" the optic nerve's ability to regenerate. The first lock, they found, was the turning off ...

1 2 3 4

(Date:8/21/2014)... (PRWEB) August 21, 2014 Recently, ... among their patients. Alternative medicine is on the ... to millenials. According to The Fiscal Times, young ... treatments over conventional medicine. , The Fiscal Times ... many millenials are embracing alternative medicine. The article ...
(Date:8/21/2014)... with advanced laryngeal cancer appear to have better ... nonsurgical chemoradiation. , Author: Uchechukwu C. Megwalu, M.D., ... Mount Sinai, New York, and colleagues. , Background: ... are diagnosed each year and squamous cell carcinoma ... Prior to 1991, total surgical removal of the ...
(Date:8/21/2014)... NC -- Researchers have pinpointed the environmental source of ... Southern California for decades. It literally grows on trees. ... of a 13-year-old girl, who spent the summer gathering ... hardest hit by infections of the fungus named ... Cryptococcus , which encompasses a number of species including ...
(Date:8/21/2014)... (HealthDay News) -- Not only is eating better and exercising ... of health-care dollars a year, a new study finds. ... health sciences at Wake Forest Baptist Medical Center in Winston-Salem, ... 2 diabetes patients. Participants ranged in age ... an intensive "lifestyle change program" focused on diet and exercise, ...
(Date:8/21/2014)... The W. Montague Cobb/ NMA ... national voice in the elimination of health disparities, ... the 112th National Medical Association’s (NMA) Annual Convention ... John Ruffin, Ph.D, former Director of the National ... life-long career and innovations have had a significant ...
Breaking Medicine News(10 mins):Health News:Van Uden Center Sees Growth in Alternative Medicine 2Health News:Surgery associated with better survival for patients with advanced laryngeal cancer 2Health News:Fungus deadly to AIDS patients found to grow on trees 2Health News:Getting Healthier a Big Money-Saver for People With Diabetes 2Health News:W. Montague Cobb/NMA Health Institute Honors Three Outstanding Leaders in Health Disparities 2
Other Tags
titantedstinkyhypertensivesdiesellaybeachremovesaceseekpreliminarymitralagesfactquotationsretarded