The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "trial" at medical news

New Data Show Evista Reduces Spinal Fractures

...uble-blind,placebo-controlled, randomized clinical trial designed primarily to evaluate theeffect of daily ...erage 66 and one-half years old upon entryinto the trial and have osteoporosis. The two-year analysis demonstrates thatwomen taking Evista who had no spinal ...

Novel Therapy Significantly Reduces Spinal Fractures In Postmenopausal WomenWith Two Years Of Therapy

...t the EuropeanCongress of Osteoporosis. The MORE trial is a multicenter, Eli Lilly and Co. sponsored rese...women who had no spinal fractures uponentry of the trial and received raloxifene were 52 percent less likely to have afirst spinal fracture and women with a ...

Patients are sought for a clinical study to determine

...an-St. Luke's Medical Center have begun a clinical trial todetermine if estrogen also improves the effectiv... drugs," said Kompoliti.Each medical center in the trial will treat 18 patients who are already onLevodopa: six will be men on Levodopa; six will be post-me...

Some CFS Patients Benefit From Low-Dose Steroid, But Side Effects Too Risky

...olleague, Robin McKenzie,M.D., designed a clinical trial to treat CFS patients with hydrocortisone, asynthe...oes not support the use of hydrocortisone, asecond trial led by Dr. Straus at NIAID together with scientists at JohnsHopkins University is attempting to supp...

Study Shows Efavirenz Promising In Treating Pediatric HIV Infection: Leads To Approval Of New Drug For Testing HIV-Infected Children

... Trials Group (PACTG), a network of trial sites supported by the National Institute of Allergy and Infectious Diseases (NIAID) and the National Institute of Child Health and Human Development (NICHD), have announced results of an in...

Beyond Pharmaceuticals: Business And Academic Leaders Forecast The Future Of "Combinatorial Chemistry"

...tems penetrate the skin, scientists are"reduced to trial and error," Kohn says. "It's like playing the lottery: if youmake and test one compound at a time, it's like buying a single ticket," heexplains. "But combinatorial methods allow you to make hundreds of compounds andtest them rapidly, so you greatly ...

Elderly Patients May Be Undertreated For High Cholesterol, Wake Forest Doctor Says

...otherwise good health. "Given the clinical trial evidence for benefit, those aged 65 to 75years and with prior coronary heart disease appeared undertreated withcholesterol lowering drug therapy," the report concluded. At the 1989 start of the Cardiovascular Health Study, sponsored by theNat...

UCSF Recruting Breast Cancer Patients For Herbal Therapy Study

...sary to conduct a clinical trial. This novel trial is a crucial first step to integrating traditional...their oncologists. However, in order for the trial to be effective, he said, participantswill be randomized to receive either the herbal formula or a p...

Study Finds Less Intensive Treatments May Not Maintain HIV Suppression

...y 1997, ACTG 343 is the first large-scale clinical trial toinvestigate whether one- or two-drug therapies c...viral load rebound. "Although the results of this trial are somewhat disappointing," notes Dr.Havlir, "they should not discourage future attempts to simplif...

Pairing Two Drugs With Angioplasty May Offer Best Success In Treating Heart Attacks

...ntific sessions. Results of a dose-ranging trial show that using abciximab and twolow-dose boluses ... a new standard of care for heartattacks, said the trial leader, Dr. Magnus Ohman, a cardiologist at the DukeClinical Research Institute. "Most pati...

Get Me To The ER On Time

...apid Early Action for Coronary Treatment, orREACT, trial presented today at the American Heart Association's 71st ScientificSessions. The study, funded by the National Heart, Lung, and Blood Institute, testedcommunity campaigns to reduce the time people delay seeking emergency care forheart attack in 20 me...

Hospital Stays Longer Than Three Days For 'Simple' Heart Attacks May Not Be Cost Effective

...tientswho had participated in the GUSTO-I clinical trial between 1990 and 1993. Theprimary purpose of that trial was to compare the effectiveness of two clotbusting drugs, but the researchers also collected a weal...

Faster Relief From Influenza Symptoms For 'High Risk' And Otherwise Healthy Patients With Inhaled Zanamivir

...nd, randomised trial. The primary endpoint of the trial wasmedian time to alleviation of clinically signif...ese findings were strongly reflected in the second trial of zanamivir2reported at the IDSA meeting by Adrian Griffin on behalf of MIST (Management ofInfluenz...

Pursuing The Next Generation Of Arthritis Treatment

...ethotrexate, the current standard treatment. This trial is beingconducted as part of a nationwide effort t...Administration. The other current clinical trial is the first test of a promising newtreatment for systemic lupus, a potentially life-threatening for...

National Clinical Trial To Test Effectiveness Of Antibiotic Treatment For Coronary Artery Disease

...ivelytreated with antibiotics? A national clinical trial directed by the Universityof Washington and funded...dea as it once was," said Grayston. "This clinical trial should help prove whether the Chlamydia pneumoniae bacteriaplays a role in the cause of complication...

First Drug Shown Effective For Treating Chronic Forms Of Major Depression

...sponded positively tosertraline in a 12-week trial and had continued to respond well in a four-month extended treatment. In the study, 77 patients maintained sertraline use for 76more weeks, while 84 patients took a placebo daily. A research team found that patients receiving sertr...

WFU And IntraVec To Develop Innovative Cancer And HIV Treatments

...In developing the new treatments and therapies for trial and use inhumans, IntraVec will work with Chen and Malcolm Brenner, M.D., Ph.D., directorof the Center for Cell and Gene Therapy at Baylor College of Medicine, whereChen is now an associate professor. The cancer treatments will use "toxic cel...

Discarded Treatment For Heart Attacks May Yet Prove To Be A Life-Saver

...nt life-saving powers, according to a new study. A trial in six Latin American countries provides new evide...emical symbol for potassium. In the pilot trial involving 407 people suffering a heart attack,patients treated with the GIK combination within 24 ho...

New approach supercharges immunotherapy

...ainstcancer. Early results from the first clinical trial of this approach will bepresented December 5th at ...ting in MiamiBeach, Florida. This phase-1 clinical trial -- designed not to assess effectiveness but todetermine the optimal dose and measure toxicity -- inv...

Promising New Drug Uses Antibody Targeted Chemotherapy To Fight Leukemia

... arenow emerging from the current pivotal Phase II trial in the U.S. that involvespatients following relapse after initial AML chemotherapy. A preliminaryanalysis of these data show that CMA-676 given alone produces a remission rate of approximately 40 percent - arate comparable to that of standard combin...

1 2 3 4 5 6 7 8 9 10

(Date:11/21/2008)...Newswire-USNewswire/ -- New research at West Virg... spitless tobacco product aimed at young adults is...RJ Reynolds, Camel Snus - touted as a socially acc...singly high levels of nicotine. , , "Camel ...products," said Bruce Adkins of the state Division...
(Date:11/21/2008)...swire-USNewswire/ -- U.S. News & World Report ...NCQA) ranked BlueChoice(R) HealthPlan of South Car...ans(TM), published in U.S. News & World Report...l ranking ranks the nation,s best health plans bas...QA accreditation scores. NCQA and U.S. News & ...
(Date:11/21/2008)...swire-FirstCall/ -- Barr Pharmaceuticals, Inc. (NY...overwhelmingly approved the proposals submitted to...Pharmaceuticals Industries Ltd. (Nasdaq: TEVA )....elming support of the transaction by the Barr shar...nd CEO. "We are pleased with the progress that we ...
(Date:11/21/2008)...y diseaseits cause remains a mysteryswept into Ath...citizens, soldiers and refugees of the war then ra...with corpses, social order broke down. Over the ne...ens lost a third of its population. It lost the wa...f the end of the Golden Age of Greece. , The Pl...
Breaking Medicine News(10 mins):Health News:Experts Say New Tobacco Product Targets Young Adults 2Health News:Experts Say New Tobacco Product Targets Young Adults 3Health News:BlueChoice HealthPlan Ranks in Top Third of America's Best Health Plans 2Health News:Barr Shareholders Approve Pending Teva Acquisition 2Health News:Barr Shareholders Approve Pending Teva Acquisition 3Health News:Barr Shareholders Approve Pending Teva Acquisition 4Health News:Study of ancient and modern plagues finds common features 2Health News:Study of ancient and modern plagues finds common features 3Health News:Study of ancient and modern plagues finds common features 4
Other Tagsalleviate 2alleviate 3alleviate 4alters 2alters 3alters 4alters 5alters 6alters 7orchestrates 2survived 2survived 3survived 4survived 5survived 6survived 7survived 8survived 9survived 10worsens 2smoke 2smoke 3smoke 4smoke 5smoke 6smoke 7smoke 8smoke 9smoke 10cigarette 2cigarette 3cigarette 4cigarette 5cigarette 6cigarette 7cigarette 8cigarette 9cigarette 10month 2month 3month 4month 5month 6month 7month 8month 9month 10rewarding 2
alleviatealtersorchestratesjudesnowballsurvivedsmearspapworsenssmokecigarettemonthyipsspellsrewardingmagnifies