Tag: "unaffected" at medical news

Protein that promotes survival of stem cells might be key to poor leukemia prognosis

...ntinued to flourish. In contrast, liver cells were unaffected following loss of Mcl-1, demonstrating that Mcl-1 is important only in certain cell types. Finally, the investigators showed that growth factors (natural proteins that stimulate cells to grow), such as the "stem cell factor," trigger the expression o...

Sex hormone metabolite reduces stress, anxiety in female rats

... hormones naturally. Acoustic startle response was unaffected in the estrogen-only group and the control group. In the estrogen-plus-progesterone group, however, CRF-enhanced startle was significantly lower than in the other groups. In another set of experiments, the researchers discovered that lactating female...

OTC treatment for acne as good as antibiotics

...t included erythromycin and benzoyl peroxide were unaffected by resistance but were not superior to benzoyl peroxide alone."...

Month of birth linked to risk of MS

...were both from the general population and from the unaffected brothers and sisters of those with MS. In Canada, significantly fewer people with MS were born in November compared with controls. Similarly in Britain, fewer people with MS had been born in November and significantly more had been born in May. The n...

Canadian researchers to develop 'smart drug' to repair psychiatric disorders

... however, the drugs may cause imbalance in normal, unaffected areas, leading to negative side effects. Side effects can range from sluggishness, insomnia and anxiety to severe psychoses, and limit prolonged use of these medications. The new generation of "smart" drugs will target only the cells where communi...

Prenatal alcohol exposure has effects far beyond fetal alcohol syndrome

...to-heavy drinking mother who has given birth to an unaffected child when she was younger needs to be warned that, if she drinks while pregnant, her risk of having an adversely affected child increases as she grows older. This risk is also greater if she has a long-term drinking problem. "Women in these high-r...

IgG treatment during pregnancy reduces severity of rare, recurring liver condition in newborns

...H in another child is 80 percent. A woman may have unaffected children before having the first one with NH. After that, most or all pregnancies end with fetal death or a child born with NH. Currently, there is no test to determine if a pregnancy will be affected, and there is no effective approach to prenatal ...

'Weekend' use matches daily drops for 'lazy eye'

...ops are designed to temporarily blur vision in the unaffected eye, thereby forcing the amblyopic eye to do most of the work. This helps strengthen the amblyopic eye and improves vision. This research was conducted by the PEDIG at 30 clinical sites throughout North America and was funded by the National Eye Ins...

Optimism associated with lowered risk of dying from heart disease

...of cardiovascular death through mechanisms largely unaffected by baseline values of physical activity, obesity, smoking, hypertension, and lipid profile, pessimistic subjects may be more prone to changes across time in risk factors that affect the progression of cardiovascular disease (e.g., the development of ...

FOSRENOL (R) maintains bone health status of end-stage renal disease patients

...orption of a single dose of 1000 mg of FOSRENOL is unaffected by co-administration of citrate. No effects of la...oxin or metoprolol. The absorption of FOSRENOL is unaffected by coadministration with citrate-containing compounds (see CLINICAL PHARMACOLOGY: In Vitro/In Vivo D...

Estrogen or stimulating environment boost memory

...memory in animals in the enriched environment were unaffected or impaired by estrogen treatment," Frick said. "Among mice not treated with estrogen, enrichment treatment alone significantly improved spatial memory. The behavioral changes were also associated with alterations in a part of the brain critical for ...

Epilepsy study shows memory loss after brain surgery

...psy surgery, SAH was originally developed to spare unaffected brain tissue from resection and thus to minimize the negative consequences of anterior temporal lobectomy, a more conventional surgical technique. Most often SAH is sufficient to eliminate recurrent seizures in patients. ...

Scientists begin validation study of test to detect recurrence of bladder cancer

...present in urine, and compared to DNA sequences of unaffected cells, such as lymphocytes, from the same patients. Early studies have shown this non-invasive analysis can have over 90 percent accuracy. In the validation study, overseen by Jacob Kagan, Ph.D., program director of NCI's Cancer Biomarkers Research G...

Preimplant test offers option of having child to serve as stem cell donor to sibling in need

...nancy termination, because PGD allows selection of unaffected embryos before a pregnancy is established, according to background information. Despite the need for ovarian stimulation and in vitro fertilization (IVF) to be part of the procedure, PGD has become an acceptable method for avoiding the birth of child...

Medical residents report sleep loss and fatigue take toll on learning, work and personal lives

...rcent) disagree with the statement "My thinking is unaffected by sleep loss or fatigue." A total of 124 (85 percent) do not agree that "My work is unaffected by sleep loss and fatigue." Ninety-five (64 percent) residents either strongly agree or agree t...

Researchers discover new clinical syndrome leading to severe osteoarthritis

...h the finding of the mutation in both affected and unaffected family members makes the mutation in and of itself insufficient to cause the clinical syndrome, it may play a role in what could be a polygenic trait. "Further studies defining the genetic mutation related to chondrolysis seen in the family we report...

New UNC study shows Hurricane Floyd boosted abuse and non-abuse brain injuries in children

...idence in North Carolina counties less affected or unaffected by the storm." Overall, child abuse brain injuries were five times more common in the hardest-hit counties in the half-year after the hurricane than before and such injuries attributable to accidents were more than 10 times as common, Keenan said. A ...

Mothers' cells can cause immunity illness in children

...their mother. This compares to 23 percent of their unaffected siblings who had maternal cells, and 17 percent of healthy children who had maternal cells in their blood. The presence of this maternal (also called "chimeric") cell is strongly associated with a particular genetic makeup of the mother. Children wit...

Major cause of painful gastroenteritis under study at MCG

...which are the main hosts for Campylobacter yet are unaffected by the infection have a higher internal temperature than people. "We are in the process of identifying proteins that are turned on in chickens and turned off in people and vice versa," Dr. Thompson said. Another aspect of his work is the durable, da...

Whole-breast irradiation after lumpectomy may protect women from recurrence long term

...reatment. "The rate of recurrence in initially unaffected parts of the breast receiving whole-breast irradiation was half that of the other breast," said Freedman. "This suggests that whole-breast irradiation may have a protective effect." The study found that the lowest risk of recurrence in other parts o...

1 2 3

(Date:5/18/2013)... Family Magazine of Washington DC was awarded the "Best ... Inc. in the category of Summer Camps in DC ... the areas best in the ultimate guide on parenting, kids ... Brenda Hyde, a mother of four and publisher of Family ... vast resources available to them in the DC Metro area. ...
(Date:5/18/2013)... (PRWEB) May 18, 2013 During Better ... loss should consider the legal protections they have, including ... problems arise with their child’s treatment or hearing aid ... Since 1927, the American Speech-Language-Hearing Association has used the ... and to promote treatment, such as cochlear implants, which ...
(Date:5/18/2013)... 18, 2013 Simple changes in a ... snacks and drinking more water can lead to substantial ... a healthier lifestyle overall. Diet Doc understands ... weight loss can be difficult and often requires the ... plans to help patients get over initial weight loss ...
(Date:5/18/2013)... 2013 6Webs.com is the leader in ... reviews and comprehensive comparisons make 6Webs.com the useful resource ... 6Webs.com just recently finished conducting their assessments of the ... Smythe from 6Webs.com reports, "There has been an increase ... ease of use, expandability and mobility. Combine these features ...
(Date:5/18/2013)... Show And Go Training, the culmination of ... systems that is all about is getting results in the ... http://ShowAndGoTrainingReview.com ’s Stan Stevenson, prompting an investigative review. ... “four phase system” designed to make you faster, stronger, fitter ... working out in the gym. The training manual and exercise ...
Breaking Medicine News(10 mins):Health News:Summer Camps in DC "Best of the Best" Awarded to Family Magazine of Washington DC for Excellence by Follow Media Consulting, Inc. 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 3Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 2Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 3Health News:Best Wireless Home Security System Companies Released by 6Webs.com 2Health News:Show And Go Training: Review Examining Eric Cressy's Workout Program Revealed 2
Other Tags
sarawakmalaysianweevilnicetrendupwardpredisposingemphasiscouricmovieadvisestraymitigatesolicitousnessgastroenteritisgatorade