Tag: "under" at medical news

Emory University researchers say cholinergic agents may offer relief from tics in adults with Tourette syndrome

...hat perhapsother agents in this category currently under investigation may prove safer andmore effective." Tourette syndrome is a neurologic disorder usually diagnosed in childrenunder age 21. Average age of patients in the current study was 24. Thecharacteristic motor and vocal tics associated w...

Study suggests a drug treatment for abdominal aortic aneurysms

...rm host tissues. Two MMPs -- MMP-2 and MMP-9-- are under suspicion because they are much more abundant in aneurysm tissuethan in healthy artery wall. They also attack elastin, a protein that helpsstrengthen the wall, enabling it to withstand the force of the heart's pumping."It is believed that the breakdo...

Scientist explain a drug's paradoxical action: discovery may lead to new therapies for breast cancer, early puberty

...a much larger project,undertaken in the Miller lab under Auchus' initiative. The group has developed astrain of "humanized" yeast that express the DNA of human enzymes. They plan touse yeast cells, converted into little versions of human adrenal glands, as ascientific model to study the action of the human...

Space plays havoc with your immune system

...le. "When these astronauts go up, they are under huge stress, the greatestbeing the fear they won't come back," says Mehta. "It's crowded, cramped andtiring, and if crew members breathe out virus, it hangs around in microgravityand can easily be breathed in." The solution might be for the ...

ILEX Oncology & LeukoSite report results from pivotal Phase II CAMPATH (R) trial; Results suggest new hope for refractory chronic lymphocytic leukemia

...d toundergo a six-month priority review by the FDA under the Prescription Drug User Fee Act. Due to its potential to address unmet medical needs for serious or life-threateningconditions, the FDA has made CAMPATH eligible for "rolling" review which means the BiologicsLicense Application (BLA) may be proces...

Can a terminally ill person want to hasten death and be mentally competent?

...theywould consider assisted suicide for themselves under certain circumstances, forother respondents, opposition to assisted suicide was strongly a function oftheir opposition to suicide per se. One third of the respondents indicated that performing such evaluations wasoutside of their practice area. Of t...

High stress hormone levels impair memory

...e effects ofcortisol in the brain when a person is under high levels of stress." A total of 51 people participated in the study -- 25 men and 26 womenbetween ages 18 and 30. They were assigned to one of three groups. One group ofseven men and eight women received a high daily dose of cortisol. A se...

Full bone mass restored to most postmenopausal women with osteoporosis in two-year trial of new treatment

...ccur only rarely in people, and primarily in those under 25 yearsold. The Food and Drug Administration advised the medical community not toadminister parathyroid hormone to young people, but the FDA recommendation didnot apply to the two-year osteoporosis study reported today, since those takingthe drug we...

WHO issues wake up call against microbial threats

...f all deaths due to infectiousdiseases among those under 44 years of age. "The World Health Organization i...nt deaths from each of these six diseases now cost under $20 perperson at risk, and in most cases under $0.35 Yet these diseases still causedover 11 million ...

Immune system rebounds for some children with AIDS, finds UF study

...different potential in young children. In children under 5, the thymusgland, which is where T cells mature,...ntial for immune system reconstitution in children under 2, those between 2 and 12, and adolescents. "We're not only going to look at the numbers of cells th...

Study examines faith healing in a cell phone age

... issue of Medical Anthropology Quarterly currently under review. In addition to six articles for Medical Anthropology Quarterly, the Navajo Healing Project has prepared a report for theNavajo Nation Division of Health on the perceptions of the Hantavirsus and articles for Natural History and AmericanEthnol...

Help for women's urinary tract infections

... transmitted disease did notincrease substantially under the standard---indicating, but not proving, thatth...n other types of healthplans to assess the impacts under those systems." Since the study's conclusion,Group Health has implemented the guideline throughout ...

"Baby check" information for parents does not affect frequency of contact with family doctors

...ation rates for the vulnerable age group of babies under six months. Dr Jewell argues that Baby Check may ...he high level of antibiotic prescribing for babies under six months...

Want to feel good? Don't smell a child, sniff your granny

...mples of their body odour by strapping a gauze pad under each armpit andkeeping it there for 10 hours. The participants were not allowed to use any perfumes or deodorants, oreat strong-smelling foods, in the four days before the samples were collected.They could shower, but only with unscented soap...

MGH study shows mitral valve prolapse not a stroke risk factor

...alyzing cardiac ultrasoundresults for all patients under 45 treated for strokes or mini-strokes (transientischemic attacks) at the MGH over a period of 10 years (1985 to 1995), theresearch team found the prevalence of mitral valve prolapse to be nearlyidentical to that seen in a control group without cardi...

Clues to heart disease seen in cholesterol reactions to stress

...iovascular disease and atherogenic lipidreactivity under stress. They report their findings in the current issue ofPsychophysiology. "We chose only men for the investigation because men generally have greaterlipid reactions to stressors than do women and because family history of heartattack is particular...

New medicare coverage makes TMR procedure more readily accessible to patients with severe angina and no options

..." he explained. "I'd have the same pain when I was under stress, trying to get somewhere on time or dealing with otherpressures." While undergoing his second angioplasty, Dr. Frischling asked his cardiologistabout the possibility of TMR, which he'd read about in a medical journal. Hisdoctor agreed that he ...

Research links fathers' job stress, other risk factors to parents' knowledge about children's daily experiences

...were related to lower levels ofparental knowledge, under certain conditions, with marital happiness being animportant factor," Bumpus says. High paternal work demands, in combination with a less happy marriage,were associated with lower levels of parental knowledge. "Happy marriages aremore lik...

New book explores timely social issues of family relationships & raising of children

...desires. Laura M. Purdy also argues that, under certain circumstances,children should be provided with some choices concerning their own lives. In"Boundaries of Authority: Should Children Be Able to Divorce Their Parents?"Purdy reviews various current positions on children's rights, focusing inpar...

Controversial performance enhancer "andro" affects brains as well as brawn, say UMass researchers

...ral studentsConstanza Villalba and Catherine Auger under the direction of professor Geert deVries. Auger is now a postdoctoral researcher at Johns Hopkins University.Although the study was conducted on rats, the implications for humans areimportant, according to the scientists. "Andro," or androste...

1 2 3 4 5 6 7 8 9 10

(Date:10/25/2014)... -- Researchers who discovered antibiotics in farmed and ... concern. The use of antibiotics in animals, ... contribute to the development of antibiotic-resistant bacteria that ... the study. Each year in the United ... and kill about 23,000, according to the Infectious ...
(Date:10/22/2014)... 2014 At a time when the ... and athletes at all levels, the UPMC Sports ... current discussion where two powerful messages are lost: Concussions ... result in full recoveries every day. , In striving ... fact and research, UPMC and the Concussion Program are ...
(Date:10/22/2014)... 22, 2014 For Dr. Iris Hunter, a ... it’s an extension of her life’s mission. Her extensive experience ... the owner of FirstLight HomeCare, make it clear that Hunter’s ... me that my work makes a difference in the lives ... spirit, so after much research, I felt ready to start ...
(Date:10/22/2014)... October 22, 2014 Hay House is pleased ... Addiction and Upgrade Your Life (Paperback; $10.82) written by the ... & Recovery. This book is meant to help readers ... life of recovery. , Recovery 2.0 is not the ... Recovery 2.0 is a guide for what comes next. ...
(Date:10/22/2014)... Losing Weight Your Body’s Way , In ... in the face, it certainly can be difficult to choose ... an extra favor by doing it the healthy way? Set ... listen to your body, exercise regularly, and choose foods with ... losing weight; you need to exercise more and eat less. ...
Breaking Medicine News(10 mins):Health News:Researchers Say Antibiotics in Fish a Health Concern 2Health News:University of Pittsburgh Medical Center Launches Initiative to Emphasize Concussions Are Treatable 2Health News:University of Pittsburgh Medical Center Launches Initiative to Emphasize Concussions Are Treatable 3Health News:University of Pittsburgh Medical Center Launches Initiative to Emphasize Concussions Are Treatable 4Health News:Dr. Iris Hunter to Host Grand Opening of FirstLight HomeCare Tomorrow 2Health News:Hay House Announces The Official Release of Recovery 2.0: Move Beyond Addiction and Upgrade Your Life 2Health News:Hay House Announces The Official Release of Recovery 2.0: Move Beyond Addiction and Upgrade Your Life 3Health News:ReductionGuruMD Presents Ways to Improve Your Weight Loss Results 2
Other Tags
doublecortindirectingpayloadsstsmaintenancetelomerealivedrunkenapplesdevicewidelyisraeliimpactmonitoringneurodegenerativeions