Tag: "unrelated" at medical news

What Makes Tics Tick? Clues Found In Tourette Twins' Caudates

... function." Although previous studies comparing unrelated Tourette patients with unaffected persons had failed to show differences in dopamine system function, the NIMH investigators were spurred by the fact that Tourette symptoms respond to drugs like haloperidol that block D2 dopamine receptors. They use...

New Approach To Multidrug Resistance

... able towithstand the actions of a wide variety of unrelated chemicals. The anti-drugpump is a major tool in multidrug resistance. The researchers have found a novel way to suppress production of the pump longenough for cancer drugs to work. Therapies for cancer treatment often use chemicals that impair the ...

Area of Research Outlined For Promising New Cancer Drugs

...protein. (Endostatin is derived from a different, unrelated protein, collagenXVIII.) Angiostatin and endostatin were discovered in the laboratory of Dr.Judah Folkman, a cancer researcher at Children's Hospital in Boston. The drugsfunction by cutting off the blood supply to tumors, making even extreme...

Walking Or Bed Rest OK For First Stage Of Labor, UT Southwestern Research Shows

...ections. "Labor and delivery outcomes were unrelated to walking, and infants'outcomes were also similar in the two study groups," Bloom concluded. "Walkingneither enhanced nor impaired active labor and was not harmful to the mothers ortheir infants. Most of those who did walk indicated that they would ...

An Ergonomically Redesigned Analgesia Delivery Device Proves Safer And More Efficient

...ed by human error (the remaining 7% had unknown or unrelated causes). However, the reliability of these figures to accurately portray the incidence of human error is likely undermined by the under reporting of human error. Therefore, a second analysis was conducted of only the incidents in which the patient su...

Antibiotics Reduce Inflammation In Heart Disease But Effect On Heart Attacks Remains Unproven

...ease. "We once thought peptic ulcers were unrelated to bacterial infection,but we know today that they can be effectively treated with antibiotics. Weneed to find out if the same could prove true of heart disease," he continues. The ongoing two-year trial reported in Circulation includes 302i...

Fetal Cell Therapy Benefits Some Parkinson's Patients

... must clarifyadverse reactions which are seemingly unrelated but cannot be ignored," said Dr.Fischbach. Previous studies of fetal dopamine cells for Parkinson's disease in the 1980sand 1990s showed what sometimes appeared to be remarkable benefits. Dopamine isa nerve-signalling chemical, or neurotransmitter, ...

Melanoma Patients' Sentinel Lymph Nodes (SLNS) Play A Strong Role In Disease Prognosis, UCSF Study Reports

...cent died of melanoma and 56 percent diedof causes unrelated to the disease. Study participants underwent a SLN dissection using selective techniques calledpreoperative lymphoscintigraphy and intraoperative lymphatic mapping. These procedures allow surgeons to pinpoint the SLN where cancer potentiallycould h...

Less Toxic Bone Marrow Transplant Technique May Have More Powerful Anti-Cancer Effect

...been achieved. The fifthpatient died from a cause unrelated to the transplant (pulmonary hemorrhage) 12days after the procedure, too early to judge whether or not the donor marrow hadengrafted. The two surviving patients are still in remission up to two yearsafter receiving their transplants. Sykes notes tha...

New biological target identified for cholesterol-lowering drugs

...o group's, theresearchers report. The changes seem unrelated to any decline in cholesterol levels. Even whenpatients in the placebo group were able to lower their low-density lipoprotein-- the so-called 'bad' component of total cholesterol -- through diet andexercise, CRP increased over time. "This drug app...

Milestone study in development of xenotransplantation

...ents, or werethere due to cross reactivity with an unrelated antigen. In two of the fourpatients there were previous samples which indicated that the antibodies werealready present at the time of treatment. Unfortunately, there were no earliersamples for the remaining two patients but these two patients were n...

Whole-organ pancreas transplants and partial liver transplant programs arepriorities for renowned transplant surgeon at Cedars-Sinai

...iving donor'sliver is transplanted to a related or unrelated individual, or in a"reduced-size" transplant, a cadaver liver is cut down to fit a smallerrecipient. "Reduced-size transplants have been around for a long time, and there arecircumstances in which they are appropriate and necessary, but they don't ex...

Job complexity, simplicity linked to substance use

.... Interestingly, the level of cocaine use remained unrelated to cognitive abilityand job complexity. "People may use substances to soothe the frustration they experience as a resultof being over- or understretched by their jobs," say the researchers. "They arejust as likely to use large amounts of substances i...

Even in an era of HAART Drugs, HIV patients are vulnerable to opportunistic infections

...s commonly areused to treat respiratory infections unrelated to MAC in all types of patients,not just the HIV population. Study results showed that the bacteria normally present in the respiratorytract of HIV patients developed high-level resistance to the antibiotics withinsix weeks of starting prophylaxis. A...

Failures following HIV post-exposure prevention provide valuable lessons for warding off future infections

...t of virus in genitalsecretions, however, is often unrelated to the amount of virus in plasma, saidRoland. In one case study, a woman engaged in protected sex after a possibleexposure to HIV and tested negative six months after PEP enrollment. However,when her partner's plasma viral load became undetectable ...

Discarded thymus tissue provides life for infants with DiGeorge Syndrome

... Even though the tissue was implanted from an unrelated donor, it cannotbe rejected in patients who lack a thymus, the researchers said, because it isthe thymus that produces immune cells that reject foreign tissue. After thetransplant procedure, the new donor thymus tissue in the thighs of thesechildren ...

Age-related declines in mental function

... consisting of rememberingthe order of a string of unrelated words; a math task, consisting of verifyingthe truth of a simple equation such as (8 x 5) - 8 = 33; a combined task,consisting of doing math while remembering a list of words; and a control tasksubstituting circles and squares for letters and digits,...

Missouri scientist takes 'rocky' road to NASA

...ll of Fame. "I ended up doing all these seemingly unrelated things. And it's a long way from 'rockology,'" he said. "But they actually all have a fundamental straightforward relationship. They all deal with images." Rickman, 48, is one of the Marshall Center's leading researchers in remote sensing the use o...

Some autistic people have memory advantage for certain tasks

...o the index word; and two were unrelated to the index word. The main difference between the subjects with ASD and those without is that those without the disorder were more likely to have thought they had heard the index word and ...

Baltimore researchers receive $40 million from Bill & Melinda Gates Foundation

...liver the DNA vaccine by itself or through viruses unrelated to the measles virus. This will allow the genetic material of the measles virus to target the most important parts of the immune system without being eliminated by measles antibodies from the mother. Once the most promising viral and bacterial vacci...

1 2 3 4 5

(Date:4/17/2014)... 17, 2014) Two recent papers by a ... colleagues may help scientists develop treatments or vaccines ... Japanese encephalitis and other disease-causing flaviviruses. , Jeffrey ... molecular genetics at the School of Medicine and ... Medical Institute, and colleagues recently published articles in ...
(Date:4/17/2014)... Le Bonheur Children,s Hospital Pediatrician-in-Chief Jon McCullers, MD, ... the April issue of Nature Reviews Microbiology ... Dr. McCullers, a world-renowned infectious disease specialist, ... the University of Tennessee Health Science Center, analyzed ... 1918, 1957 and 1968 pandemics, as well as ...
(Date:4/17/2014)... April 17, 2014U.S. military personnel who served in ... concussive traumatic brain injury (TBI) were compared to ... other medical reasons. Differences in measures of overall ... months after injury are reported in an article ... journal from Mary Ann Liebert, Inc., publishers. The ...
(Date:4/17/2014)... million older Americans suffer from depression, often brought on ... research a project that followed the lives of ... found that Internet use among the elderly can reduce ... , "That,s a very strong effect," said Shelia Cotten, ... and media who led the project. "And it all ...
(Date:4/17/2014)... about one in five infants in the United States ... first several months after birth. Research into probiotic use ... the April 1, 2014 issue of the British ... study, "Probiotics and Infant Colic," concluding that the use ... colic did not reduce crying or fussing in ...
Breaking Medicine News(10 mins):Health News:CU researchers discover target for treating dengue fever 2Health News:Long-term effects of battle-related 'blast plus impact' concussive TBI in US military 2Health News:Internet use can help ward off depression among elderly 2Health News:New study says probiotic use for infant colic is not effective in reducing symptoms 2
Other Tags
greatlyrumorsintegrityoctopussecretsbacteriumanthraxpotentialscreendefencesevadeshieldlovedincapacitatedwishespacemaker