Tag: "vessels" at medical news

Shark-Liver Substance May Slow Growth Of Brain Tumors

...ark substance nearly stops the growth of new blood vessels that nourish solid brain tumors. The results sugge...ntaining squalamine slowed the growth of new blood vessels caused by tumors in rabbits' eyes by up to 43 percent after three weeks. The studies are to be prese...

Routine Dental X-ray May Be A Valuable Tool In Stroke Prevention

...alcium deposits in the carotid arteries, the large vessels on both sides of the neck that supply blood to the brain. In a review of dental X-rays, they detected calcifications in the carotid arteries -- a sign of advanced atherosclerosis, a major cause of stroke -- in 5 percent of the dental X-rays of...

"Super Aspirin" Holds Long-Term Benefits For Some Patients Who Undergo Balloon Angioplasty

... from sticking to arterial walls and reclogging vessels after the procedure. Results of a multicenter study published in the August 13 issue of The Journal of the American Medical Association (JAMA) demonstrate a favorable effect on long-term outcome and survival in selected patients treated...

Scientists Track Effectiveness Of Migraine Drugs With Ultrasound

...e pain of a migraine headache comes when the blood vessels dilatesuddenly. Conventional treatment, such as beta blockers, dilate the vessels toallow for more regular blood flow. The patients in this study received various prescribe...

NIH Honors Emory Researcher With Merit Award For Work On Renin-Angiotensin System

...CE , found in the lungs, the kidneys, and in blood vessels throughoutthe body, is the form commonly associated with control of blood pressure, butthe other form-testis ACE-is made exclusively by developing male sperm cells. Bernstein's study of testis ACE has focused on two critical dilemmas:(1) How i...

Cattle: Latest Weapon In The War On Cancer?

...hey alsoappear to inhibit the development of blood vessels to the cancer, whichallows them to spread round the body," Dr Harper explains. "The shark cartilage extract market is already worth $1 billiona year in the US alone æ but, worldwide, sharks are in short supply. Our marine scientists believe t...

Researchers Finding May Boost Effectiveness Of Anti-HIV Drugs

...lures." Pgp is also expressed in the blood vessels lining the brain, known asthe blood/brain barrier. Because HIV is known to take up residence in the brain,the researchers were interested in whether Pgp prevents protease inhibitors fromcrossing that barrier. They found that when they injecte...

Heart Attack Survivors Can Lower Stroke Risk By Taking Cholesterol-Lowering Drug, Study Says

... The vast majority of strokes occur when the vessels providing blood andnutrients to the brain are blocked by cholesterol-laden plaque, which breaksfree from the inner lining of the heart's coronary artery. Heart attacks resultwhen coronary arteries are obstructed by atherosclerosis. "The key p...

Diuretic Drugs May Have Clot-Busting Effects

...lots normally form to prevent blood loss whenblood vessels are cut or damaged. But unwanted blood clots can ... helps stimulate the heart andconstricts the blood vessels -- actions that can raise blood pressure. Thescientists found that chloride, a mineral naturally fou...

American Heart Association Comment On New England Journal Of Medicine Report OnCalcium Antagonist Nisoldipine (March 5 issue)

...lcium antagonists dilate (relax) constricted blood vessels and thusreduce blood pressure. However, this vasodilator action may force the heart topump harder and may also stimulate stress hormones. This action is the oppositeof beta-blockers that limit cardiac output, notes Izzo, professor of medicineand p...

Added Benefit Found For Aspirin Use In Patients With Vessel Disease

DALLAS, March 3 -- When blood vessels malfunction because of excessivefatty buildup, asp...hich is caused by fatty deposits clogging theblood vessels -- occurs, the result can be damage to the endothelium that linesthe inside of the vessel. When ther...

Adding Progestins May Negate Heart Protection From Estrogen Replacement Therapy

...ctivity, often declines after age 50, making blood vessels stiff andless effective in delivering blood to the...utes, the cuff is deflated and images of the blood vessels are recordedby ultrasound as the blood rushes into the vessel. A similar degree of vesseldilation w...

Successful Cancer Therapy May Doom Later Treatments To Failure

...rs shrink, so do themicroscopic pores in the blood vessels surrounding the tumors -- so much so thatsome tumo...ody had measured resistance to blood flow in tumor vessels before. It was like walking into a wide open field," he says. Jain and his colleagues showed that th...

ACE-Inhibitors Score High In Reducing Heart Attack Deaths

...a chemical called angiotensin that causes theblood vessels to constrict. When blood vessels widen, blood pressure islowered. The study found that for every 1,000 individuals treated, five liv...

Fast Food Can Speed Up Clogging Of The Arteries

...he blood vessels. It is thought that blood vessels can oxidize cholesterol, leading to acollection of fat called plaque. But the new study finds that foods in the"Western" diet containing oxidized cholesterol -- cooked, fried or processedfoods, meats, eggs and dairy products chief among them -- add ...

Study Reveals Possible Clue For Racial Differences In Prevalence Of High Blood Pressure

...t, Lung, and BloodInstitute, report that the blood vessels of healthy blacks don't relax as muchas healthy whites. Blood vessels relax and widen during stress to redirectblood flow to muscles involved in the "flight or fight" res...

Drug Combination Including New "Super Aspirin" Drug Cuts Risk Of Death Or Second Heart Attack

...telets from forming blood clots thatobstruct blood vessels and cause heart attacks. Through a different mechanism,aspirin has a much weaker effect on platelets. Lamifiban was used alone in varying doses and in combination withheparin, a blood-thinning agent. The new drug combination may be ...

Anti-Migraine Drugs Might Cause More Pain Than Relief For Those With Heart Disease

...he American HeartAssociation that studies of blood vessels in the lab show that several migrainemedications cause the vessels feeding the heart to contract. If these vessels,called coronary arteries, are already narrowed by h...

By Losing (Molecular) Weight, A Clot-Dissolving Drug May Be In Better Shape To Help People Avoid A Repeat Heart Attack

..." protein released into the bloodstream when blood vessels are inflamedor when a person has a heart attack or...parin helps keep blood flowing normallythrough the vessels by preventing proteins such as von Willebrand factor fromclogging the vessels. Enoxaparin was found ...

Novel Therapy To Treat Lung Cancer Patients Enrolling Patients At UCSF Cancer Center

...vel drug they hope will inhibit the growth ofblood vessels that nourish tumor cells. The drug, developed by Genentech, Inc., is a protein known as an antibody thatrepresses a growth factor called VEGF, or vascular endothelial cell growthfactor. This therapy has been shown to inhibit the growth of cancer c...

1 2 3 4 5 6 7 8 9 10

(Date:6/19/2013)... 19, 2013 Elsevier, a world-leading provider of ... announced today the publication of the National Osteoporosis ... management of osteoporosis in postmenopausal women and older ... Published in 2009 in Maturitas , the ... update is timely with an additional focus on ...
(Date:6/19/2013)... June 19, 2013 Ultimate Medical Academy ... an 11.5-hour broadcast on WFLA News Channel 8. Since ... more than $84 million for All Children's Hospital in ... themed "30 Years of Miracles," marked the second year ... UMA employees worked the phones during the Telethon, which ...
(Date:6/19/2013)... Next Thursday, June 27, 2013, ... organization, and Muzzy Lane Software , a ... the Games for Health community to their interactive ... toward students in grades 4-7 and designed to ... positive choices. The game is part of a ...
(Date:6/19/2013)... Recently, SoCal CEO Magazine staff was on hand ... in a series of six workshops where people with and without ... the mosaic tiles in their permanent location under the direction of ... Maxwell. , This mural project began in March of 2013 ... three years ago with the goal of promoting ...
(Date:6/19/2013)... (PRWEB) June 19, 2013 Maui'd ... is dedicated to being an effective and cost effective ... needs. They have partnered up with Tom Barefoot’s Tours ... discounts on most of Hawaii’s activities. , They have ... clients can get the lowest prices on their Hawaii ...
Breaking Medicine News(10 mins):Health News:Ultimate Medical Academy Rallies in Support of All Children's Hospital 2Health News:Ultimate Medical Academy Rallies in Support of All Children's Hospital 3Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 2Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 3Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 4Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 5Health News:Arc Creates Huge Mosaic Mural to Highlight the Need for Greater Respect of People with Disabilities 2Health News:Maui'd Forever Pleased to Offer Price Guarantee on Hawaii Activities 2
Other Tags
capillarymaterialisemisshapentacticsoupamchitkapassivelawnsstaraffirmsmelodyunbornregretbeverageassurefao