Tag: "dweck" at medical news

Fixed versus growth intelligence mindsets: Its all in your head, Dweck says

... Dweck's teacher that year, Mrs. Wilson, seated her students around the room according to their IQ. The girls and boys who didn't have the highest IQ in the class were not allowed to carry the flag during assembly or even wash the blackboard, Dweck said. "She let it be known that IQ for her was the ultimate measure...
(Date:5/17/2013)... Shenzhen, China---- Why Tibetan antelope can live at ... a collaborative research published in Nature Communications ... institutes provide evidence that some genetic factors may ... highland environments. The data in this work will ... and the biology of other ruminant species. , ...
(Date:5/17/2013)... team of scientists using a new X-ray method recorded ... frog embryo in greater detail than ever before., This ... and the search for new treatments for genetic diseases., ... Technologie in Germany, in collaboration with the Advanced Photon ... Laboratory, released the most precise depiction ever of the ...
(Date:5/16/2013)... fast food restaurant had a higher body mass index ... food, according to researchers at The University of Texas ... strong among those with a lower income. , ... Journal of Public Health indicates higher BMI associates ... among lower-income African-Americans, the density, or number, of fast ...
Breaking Biology News(10 mins):The genome sequence of Tibetan antelope sheds new light on high-altitude adaptation 2New X-ray method shows how frog embryos could help thwart disease 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 3
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan