Tag: "early" at medical news

Chinese children with hearing devices benefit from new speech test

...earing impaired children identified through Chinas early screening and intervention programs increases, said Dr. Zheng, who is also vice president of the Chinese Academy of Audiological Rehabilitation (CAAR). She further points out that audiological assessment tools like the MESP are essential for all inte...

Pot bellies linked to early signs of cardiovascular disease

...ants who had noninvasive imaging tests to look for early signs of plaque build-up in the arteries, which si...netic resonance imaging (MRI) was used to look for early signs of atherosclerosis in the walls of the aorta. Researchers then examined the relationship bet...

Waist-to-hip ratio may better predict cardiovascular risk than body mass index

...r people is to prevent accumulation of central fat early on in their lives. To do so, they will need to develop lifelong dietary and exercise habits that prevent the development of the pot belly....

MRI finds breast cancer before it becomes dangerous

...st 2007) could lead to a change of paradigm in the early diagnosis of breast cancer. It states that magneti... more accurate than mammography in diagnosing very early stages of breast cancer . Up to now MRI was thought to be hardly suited for the detection of such 'd...

Pathway links inflammation, angiogenesis and breast cancer

...mTOR. Rapamycin and similar mTOR inhibitors are in early clinical trials for a number of cancers at M. D. Anderson and elsewhere. One drug, temsirolimus, has been approved to treat renal cell carcinoma. Hung's lab is exploring the possibility that this TNFa-driven activation of mTOR is the molecular link...

NIH scientists target future pandemic strains of H5N1 avian influenza

...research could possibly help to contain a pandemic early on. Making a vaccine against an existing strain of H5N1 or any other type of influenza virus is relatively routine. Typically, samples of existing influenza virus strains are isolated and then grown inside eggs or in cell cultures. The virus is the...

Galileo to support global search and rescue

...he European Commission. When fully deployed in the early years of the next decade, it will be the first civilian positioning system to offer global coverage....

Diet foods for children may lead to obesity

... food. "The use of diet food and drinks from an early age into adulthood may induce overeating and gradual weight gain through the taste conditioning process that we have described," Pierce said. Pierce added that his team's "taste conditioning process" theory may explain "puzzling results" from other...

Drug-eluting stent controversy explored in the American Heart Hospital Journal

...l of DES use, in contrast to the triumphs of their early success. Subacute stent thrombosis due to incomplete intimal coverage, the formation of blood clots that can occur when the inner layers of blood vessels are not fully treated, remains the Achilles heel of DES use, says Dr. Sigwart. The polymer matri...

Study reveals gaps in vaccine financing for underinsured children

...on of publicly purchased vaccines between 2004 and early 2006 to restrict access to selected new vaccines for underinsured children. The most commonly cited barriers to implementation in underinsured children were lack of sufficient federal and state funding to purchase vaccines. Assuming 14 percent of c...

Michigan-CDC study supports value of social restrictions during influenza pandemics

...schools and cancelled public gatherings relatively early in the pandemic and sustained these measures for about 10 weeks. The analysis shows that St. Louis had one of the largest drops in mortality while the NPIs were in force. As a whole, the studys findings contrast markedly with the conventional wisd...

Rutgers professor Bart Krekelberg is named 1 of 20 US Pew Scholars for 2007

...e possible to develop more effective treatments or early detection methods for such disorders. Born in the Netherlands and now residing in Hoboken, NJ, Krekelberg has a masters degrees in theoretical astrophysics and in cognitive artificial intelligence from Utrecht University, and earned his Ph.D. in ma...

Novel candidate biomarker for heart failure also strongly predicts risk of death

...e American College of Cardiology that has received early online release, an international research team describes finding that blood levels of a protein called ST2 both indicate the presence of heart failure among patient with shortness of breath and powerfully predict the risk that a patient will die duri...

Early-childhood intervention may improve well-being through young adulthood

...o participated in the program during preschool and early school years also were more likely to be working f...ntial cost savings to governments and taxpayers of early childhood prevention programs are considerable, they write.(Arch Pediatr Adolesc Med. 2007;161(8):73...

ACC/AHA release revised UA/NSTEMI guidelines

... of NSTEMI. The 2002 guidelines recommended an early invasive strategy diagnostic angiography and reva...h- and low-risk UA/NSTEMI groups, and recommend an early invasive strategy for unstable and high risk patients, with an initial conservative (non-invasive) s...

Annals of Internal Medicine tip sheet for Aug. 7, 2007, issue

...iglitazone. (This Perspective piece is published early online by Annals of Internal Medicine at www.annals.org. Authors appeared before the FDA advisory panel on cardiovascular ischemic/thrombotic risks of the thiazolidinediones on July 30, 2007.) 2. Geriatric Conditions Are Common but Often Overloo...

U of M report says early-childhood intervention improves well-being through young adulthood

...o participated in the program during preschool and early school years also were more likely to be working f...ntial cost savings to governments and taxpayers of early childhood prevention programs are considerable. Children who participated in this program had a g...

Statin drugs may delay progressive artery damage in children

...s young as age 8 safely and effectively delays the early artery damage caused by familial hypercholesterole...f the American Heart Association. Our data support early initiation of statin therapy in FH children, which might yield a larger benefit in the prevention of...

European heat waves double in length since 1880

... sign of global warming; one that perhaps began as early as the 1950s, when their study showed some of the highest trends in summer mean temperature and summer temperature variance. "These results add more evidence to the belief among climate scientists that western Europe will experience some of the hig...

Study shows radiofrequency ablation highly effective in treating kidney tumors

...s been used successfully in liver tumors since the early 1990s and has more recently been adapted for treatment of RCC. Renal cell carcinomas that are smaller than 3.7 cm in diameter can be reliably and safely eradicated with percutaneous RFA, Zagoria and his colleagues conclude in the report. This ...

1 2 3 4 5 6 7 8 9 10

(Date:5/22/2013)... biodiversity of pollinating insects and wild plants have slowed ... Researchers led by the University of Leeds and the ... of dramatic reductions in the diversity of species in ... 1980s. , But the picture brightened markedly after 1990, ... among bees, hoverflies and wild plants. , ...
(Date:5/21/2013)... shows that the nation,s land and water resources could ... up to 25 billion gallons of algae-based fuel a ... yearly needs. , The findings come from an in-depth ... to grow significant amounts of algae in large, specially ... May 7 issue of Environmental Science and Technology ...
(Date:5/21/2013)... Michigan Water Center today awarded 12 research grants, ... and protection efforts. , The two-year grants of ... efforts to track the remediation of harmful algae ... non-native weedy plant invasions; study chromosomal damage in ... restoration activities. , The grants were awarded to ...
Breaking Biology News(10 mins):Encouraging signs for bee biodiversity 2Encouraging signs for bee biodiversity 3Going green: Nation equipped to grow serious amounts of pond scum for fuel 2Going green: Nation equipped to grow serious amounts of pond scum for fuel 3Going green: Nation equipped to grow serious amounts of pond scum for fuel 4U-M Water Center awards $570K in Great Lakes restoration grants 2U-M Water Center awards $570K in Great Lakes restoration grants 3U-M Water Center awards $570K in Great Lakes restoration grants 4
Other Tags
penniesswallowgabapentinrelievedlocationtanningguardiansleuthresponsibilitywalkspercentagerankingsavoidscoolingminiinvestigated