Tag: "food" at medical news

Smoking may strongly increase long-term risk of eye disease

...r common risk factors. The participants answered a food frequency questionnaire and had retinal photos taken at five-year and 10-year follow-up exams. An interviewer-administered questionnaire assessed participants smoking status. BMI and blood pressure were also measured. Current smokers were found to ...

Pot bellies linked to early signs of cardiovascular disease

...dont have to clean our plates. Its better to throw food out than add it to our waists. Using the waist-to-hip measurement to gauge cardiovascular risk has certain clinical advantages, said Raimund Erbel, M.D., West German Heart Center Essen. The WHR can be easily measured, taking only a few moments and ...

Disability payments may spur drug abuse

... aid from cash payments to in-kind support such as food or housing assistance. ...

Hormone regulates fondness for food

... have discovered that the appetising properties of food have strong effects on the same key brain regions ...ence and the rewarding or appetising properties of food play a major role and can lead to overeating when they over-ride the biological cues that govern hun...

Diet foods for children may lead to obesity

...ontends that animals learn to connect the taste of food with the amount of caloric energy it provides, and...he energy value of their food. "The use of diet food and drinks from an early age into adulthood may induce overeating and gradual weight gain through th...

'Heroes of Chemistry' honored for medical, energy, environmental breakthroughs

...products and a process that improves packaging for food are the inventions of the 2007 Heroes of Chemistry... produce plastic pipe, film, detergent bottles and food and beverage containers. S1H is the first and only commercial process to selectively produce comonom...

Where's the beef? Not enough of it is on elders' plates, muscle-metabolism study suggests

...just as good as young ones at turning protein-rich food into muscle. A new study published today suggest... diet containing a moderate amount of protein-rich food such as beef, fish, pork, chicken, dairy or nuts may help slow the deterioration of elderly peoples ...

Parents' depression can weigh on children

...o lose weight. Often, children only have access to food at home, so what a parent puts on the table usually determines what the child eats, Janicke said. Also, the behaviors a parent models affect the lifestyle choices a child makes, too. When parents are struggling, they may have less energy and not be...

Diets high in choline may increase risk for colorectal polyps

...Journal of the National Cancer Institute . Major food sources of choline include red meat, eggs, poultry, and dairy products. Choline is involved in a biochemical process known as one-carbon metabolism. Studies have shown that people with increased intake of other nutrients required for one-carbon metab...

Young children's taste preferences may be influenced by fast-food branding

.... Food marketing to children is widespread. The food and beverage industries spend more than $10 billio... childs race/ethnicity, age, exposure to McDonalds food and toys and television viewing habits. A total of 63 children completed the study and performed...

Old McDonald's has a hold on kids' taste buds, Stanford/Packard study finds

...ids under 8 years old. "Kids don't just ask for food from McDonald's," said Thomas Robinson, MD, direct...ts would likely be familiar with the brand. Each food sample was divided into two identical portions, one wrapped in a McDonald's wrapper or placed in a M...

Fine as North Dakota wine

...ey thought was California wine, rated the wine and food as tasting better, and ate 11% more of their food. They were also more likely to make return reservations. It comes down to expectations. If you think a wine will taste good, it will taste better than if you think it will taste bad. People didnt...

Fat is the new normal, FSU researcher says

...at people eat more -- and thus gain weight -- when food prices drop, but thats just part of the story behind the nations dramatic weight gain since the late 1970s, according to the researchers. The full price of a calorie has dropped by about 36 percent relative to the price of consumer goods since 1977, ...

Organic farming can feed the world, U-M study shows

...rganic farming can yield up to three times as much food as conventional farming on the same amount of land...hat organic farming methods cannot produce enough food to feed the global population. Researchers from the University of Michigan found that in developed...

Plants uptake antibiotics

...epartment of Agriculture (USDA), evaluated whether food crops accumulate antibiotics from soils spread wit...as evaluated in a greenhouse study involving three food crops: corn, lettuce, and potato. Plants were grown on soil modified with liquid hog manure contain...

K-State researcher working on a way to make snack foods with extra fiber

...bran separately from the flour. Alavi said snack food producers may be able to use this precooking method to add fruits and vegetables to snack foods. "With fruit- and vegetable-based snacks, it's still hard to process the dough, so you really don't see those kinds of products out there," he said....

Chemical in brain acts like a fuel gauge

... that a drop in blood sugar triggers a craving for food is best understood just before lunchtime. But exactly how the process unfolds has proven difficult to explain, even on a full stomach. Solving the puzzle would yield new insights in the fight against diabetes. Neuroscientists at the University o...

A new direction: Integrating best-practices to improve food responses

...est-practice standards for emergency international food aid will improve the quality, timeliness and appropriateness of food aid, reports Daniel Maxwell, PhD, research director for Food Security and Complex Emergencies at the...

Columbia dentists to improve oral health in sub-Saharan Africa

...l erosion because of the presence of sand in their food as a result of the arid environment and lack of wa...a where the population has little access to sugary food and fermentable carbohydrates, we didnt expect the problem to be as bad as it is. Developing a susta...

Paying taxes, according to the brain, can bring satisfaction

...then give a little extra voluntarily to your local food bank. University of Oregon scientists have found t...aging (fMRI) as they watched their money go to the food bank through mandatory taxation, and as they made choices about whether to give more money voluntari...

1 2 3 4 5 6 7 8 9 10

(Date:11/6/2014)... yet progress in preventing and treating migratory cancer ... challenging to design drugs that work against metastasis," ... at Harvard Medical School. , "Unfortunately, many ... , Gujral and colleagues have now identified a ... how metastasis begins. Their findings may also inform ...
(Date:11/5/2014)... Rio de Janeiro, Brazil -Individuals show great diversity in ... importantly, males and females greatly differ in their perceptual ... kinds of smell tests. , Sex differences ... social behaviors and may be connected to one,s perception ... and emotions. Thus, women,s olfactory superiority has been suggested ...
(Date:11/4/2014)... marketing directed at children on the interior and ... the majority of black, middle-income and rural communities ... Authored by Arizona State University researcher Punam Ohri-Vachaspati ... to examine the use of child-directed marketing on ... and its relationship to demographics. It adds to ...
Breaking Biology News(10 mins):Migration negation 2Migration negation 3The female nose always knows: Do women have more olfactory neurons? 2Fast food marketing for children disproportionately affects certain communities 2Fast food marketing for children disproportionately affects certain communities 3
Other Tags
bloomduecorpsesmellyvalvesimplifyarisingschrenkinsurancecirrhosiscelecoxibtooculpritfindresearchersstanford