The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "globalization" at medical news

What the news and the movies leave out: Behind the scenes of disaster aid

...fing, as calling it "a second tsunami of corporate globalization and militarization." Calling into question the perception that aid is driven by need, Walker notes that it is driven by competing realities that can pull aid agencies off course. "It is driven by the wishes and emotions of the general public that pr...

Foodborne Threats to Health

...ce to lessen these risks. Topics will include the globalization of the food supply, illnesses associated with foodborne threats, regulatory responsibility, and research and policy opportunities to reduce the danger. DETAILS: 9 a.m. to 5:45 p.m. on Oct. 25, and 8:30 a.m. to 4:15 p.m. on Oct. 26, in Room 100 of ...

Globalization: Children and working parents pay too high a price

... groundbreaking study devoted to understanding how globalization is affecting working families around the world. Th... nations. An unprecedented window on the impact of globalization on families, Forgotten Families describes in vivid detail startlingly common shared experiences from...

'GreeneChip' -- New diagnostic tool that rapidly and accurately identifies multiple pathogens

...e director of the Greene Laboratory. Implicit in globalization is the risk of known or new agents that appear in novel contexts. In 1996 a presumptive diagnosis of Ebola viral hemorrhagic fever in two children who had recently returned to New York City from West Africa resulted in closing a hospital emergency r...

Resurgence and spread of syphilis in China is a rapidly increasing epidemic

...in syphilis infection rates to economicreforms and globalization in China. These changes have led to incomegaps and a cultural climate that favors re-emergence of prostitution due to a substantial majority of men and a large migrant population of male workers, the report says. Changing social practices such as peo...

Asia Pacific Family Medicine moves to BioMed Central's open access platform

... of the increased exposure, leading to the greater globalization of the publication. Additionally, APFM expects the move to help increase awareness of the practice of family medicine in the regions developing countries. We believe open access represents the future of academic publishing and BioMed Central pro...

1

(Date:11/19/2008)... worms, sponges, jellyfish - have the simplest eye...ls: a photoreceptor cell and a pigment cell. These...o-eyes, suggested by Charles Darwin as the first e...m images but allow the animal to sense the directi...s the swimming towards light exhibited by many zo...
(Date:11/19/2008)...,s Research Hospital have gained new insights into... called calpains. , As the cell,s molecular ove...cesses, including the movement of cells in tissues...nd brain cell and muscle function. The downside of...ive or overactive calpains have been linked to an ...
(Date:11/19/2008)...lapse of star-forming clouds to the flow of the mo... in your car engine to the coursing blood in your ...entration of microscopic animals in the ocean, man... of fluid flow. , The 61st Annual Meeting of the...amics, which takes place from November 23-25 at th...
(Date:11/19/2008)...he ancient thinker Archimedes shouted "Eureka" in ...t, scientist though the ages have solved many of l...day, the field of fluid dynamics addresses some of... engineering, alternative energy, and medicine. La...the year devoted to the dynamics of fluids convene...
Breaking Biology News(10 mins):Uncovering secrets of life in the ocean 2New insight into the controls on a go-to enzyme 2New insight into the controls on a go-to enzyme 3The physics of star-forming clouds and the urban environment 2The physics of star-forming clouds and the urban environment 3The physics of star-forming clouds and the urban environment 4The physics of star-forming clouds and the urban environment 5The physics of star-forming clouds and the urban environment 6Jupiter's shrinking red spot 2Jupiter's shrinking red spot 3Jupiter's shrinking red spot 4Jupiter's shrinking red spot 5Jupiter's shrinking red spot 6Jupiter's shrinking red spot 7Jupiter's shrinking red spot 8Jupiter's shrinking red spot 9Jupiter's shrinking red spot 10Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 1Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 2Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 3Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 4Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 5Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 6Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 7Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 8Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 9Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 10Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 11Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 12Carlos A Parra Joins Alexza Pharmaceuticals as Vice President Quality 19558 1Carlos A Parra Joins Alexza Pharmaceuticals as Vice President Quality 19558 2Dont Wait for the Election to Plan Your Long Term Healthcare Insurance Leader Advises 19556 1Dont Wait for the Election to Plan Your Long Term Healthcare Insurance Leader Advises 19556 2QLT Inc announces agreement for sale of real estate 19553 1QLT Inc announces agreement for sale of real estate 19553 2QLT Inc announces agreement for sale of real estate 19553 3
Other Tagsalleviate 2alleviate 3alleviate 4alters 2alters 3alters 4alters 5alters 6alters 7orchestrates 2survived 2survived 3survived 4survived 5survived 6survived 7survived 8survived 9survived 10worsens 2smoke 2smoke 3smoke 4smoke 5smoke 6smoke 7smoke 8smoke 9smoke 10cigarette 2cigarette 3cigarette 4cigarette 5cigarette 6cigarette 7cigarette 8cigarette 9cigarette 10month 2month 3month 4month 5month 6month 7month 8month 9month 10rewarding 2
alleviatealtersorchestratesjudesnowballsurvivedsmearspapworsenssmokecigarettemonthyipsspellsrewardingmagnifies