Tag: "group" at medical news

Rockefeller University researchers are changing the face of drug addiction treatment

...tingency management from the vantage point of each group of participants, will inspire other people to thin...e beginning, like celebrating each attendance at a group meeting or each drug-free test result. Later, patients can move on to larger achievements like stabl...

American Thoracic Society Journal news tips for April 2005 (first issue)

... and nonsurvivors. The median time for the entire group in the transplant study was 240 minutes. Results were unaffected by the organ preservation fluid used. The investigators believe that expected graft ischemic time should be incorporated into the decision-making process at the time of graft acceptan...

Asthma patients' immune systems respond differently with allergies

...gic rhinitis symptoms. Dr. Leal-Berumen says the group now plans to study cell response to more specific allergens similar to what was done with the prostaglandin challenge. They believe these studies will contribute to a better understanding of asthma, allergy and other inflammatory disease and guide th...

Top anti-arthritis drugs cause skin disease

... led them to visit a skin specialist. In a control group of patients who were not undergoing TNF-alpha blocking therapy and had less severe disease only 13% visited a dermatologist during the same period of time. The most frequent conditions that patients on therapy suffered from were: skin infections - 33...

Pezcoller Foundation-AACR International Award for Cancer Research

...e 3-kinase (PI3K), an enzyme that puts a phosphate group on the membrane lipid phosphatidylinositol. Although prior work in the 1950s had shown that phosphatidylinositol was phosphorylated in human tissues, Cantley's laboratory discovered an enzyme that could phosphorylate a unique position on phosphatidy...

In treatment of depression, cognitive therapy and medication both effective

...ognitive therapy (n = 60). Those in the medication group were given paroxetine or placebo for eight weeks, ...e hydrochloride. Patients in the cognitive therapy group attended 50-minute sessions twice weekly for the first four weeks, once or twice weekly for the midd...

Genetic link to cervical cancer

...n activating and inhibitory signals generated by a group of protein receptors called killer cell immunoglobulin-like receptors (KIRs). These receptors bind to partner proteins that are expressed on virtually all cell types. Carrington and colleagues found that individuals who have more inhibitory than act...

Study shows that a kidney transplant can reverse heart failure

...ey transplant as soon as possible." He says this group of patients should be encouraged to seek a living kidney donor since the national waiting time for a deceased donor kidney transplant can average three to five years, according to the United Network for Organ Sharing. Dr. Wali says it is not clear w...

Onion compound may help fight osteoporosis

...ptide called GPCS. The researchers then obtained a group of isolated bone cells from newborn rats and exposed the cells to parathyroid hormone to stimulate bone loss, then exposed some of the treated cells to GPCS. Treatment with GPCS significantly inhibited the loss of bone minerals, including calcium, wh...

Exercise, stress management show physiological benefits for heart patients

...dical therapy. Patients randomized to the exercise group participated in 35 minutes of supervised aerobic e...ere expected, showed that patients in the exercise group had the largest improvements in such measures as exercise duration and aerobic capacity. For the psy...

Once-a-month injectable medication helps treat alcohol dependence

...showed significant interaction with the medication group on treatment outcome, with men and those with lead...cent in the 380-mg. and 6.7 percent in the 190-mg. group and 6.7 percent in the placebo group. Overall, rate and time to treatment discontinuation were simil...

Maternal iron deficiency disrupts mother/child interaction

... supplements and those who did not, as well as the group of iron sufficient women, were videotaped interacting with their babies again. Analysis of the tapes showed that the mothering of the women who were iron sufficient and those who received supplements differed from those who were mildly iron deficien...

Diuretics best initial therapy for both black and nonblack patients in treating high blood pressure

...ness and death from hypertension of any population group in the United States and is among the highest in the world. Death related to hypertension and the risk of end-stage renal disease (ESRD), coronary heart disease (CHD), heart failure (HF), and stroke are increased in the black compared with the white ...

Music improves sleep quality in older adults, researchers find

...mly designating them in equal numbers into a music group and a control group. They discovered that the 30 w...spiratory rates. "The difference between the music group and the control group was clinically significant," said Lai, lead author of the study. "The music gr...

Risk of HIV transmission highest in early stage of infection

...us Diseases , now available online. Conducted by a group of investigators led by Maria J. Wawer of Columbia University, the study is the first to present empirical data showing that the rate of heterosexual HIV transmission per coital act varies over the course of HIV infection. The investigators found tha...

Asthmatics naturally deficient in antiviral immunity, report scientists

...ected cells was increased 50-fold in the asthmatic group compared with the healthy control group, who were almost completely protected from infection of their lung cells. The asthmatic cells displayed very deficient interferon responses, and the researchers found that replacing the interferon protected the...

Insomnia, falls in elderly linked

...drugs to help them sleep, because the elderly as a group account for 30 percent of all such prescriptions." Meanwhile, he says, falls are also a major problem for the elderly, especially those living in nursing homes. "One in three adults over 65 falls each year, and falls are the leading cause of injury-r...

People can learn motor skills by watching

...clockwise or counterclockwise force field. A third group was simply asked to rest and watch nothing. The subjects were not told about the forces or their roles in the experiment. The researchers found that, compared to subjects who watched nothing, those who observed the video of the "clockwise force field...

ISHLT updates guidelines for heart and lung transplants

...reated several task forces, comprised of a diverse group of its members, all of whom are active in transplant medicine. The task forces are reviewing: criteria for placing patients on a waiting list for a donor organs; pharmacological, surgical and device based intervention to successfully bridge patients ...

Mediterranean diet leads to longer life

...elderly people, who represent a rapidly increasing group in Europe, they conclude....

1 2 3 4 5 6 7 8 9 10

(Date:6/18/2013)... for Molecular Pathology is proud to announce it will ... (FASEB) on July 1, 2013. The FASEB Board approved ... , The 26 constituent societies of FASEB represent more ... the advancement of research and education in biological and ... important now than ever," said Jennifer L. Hunt, MD, ...
(Date:6/18/2013)... of internationally recognized feline experts including veterinarians and feline ... of Lincoln, U.K. and Dr Ilona Rodan, Director of ... International Society of Feline Medicine (ISFM) and the American ... veterinarians, owners and those working with cats on how ... The new guidelines appear in the Journal of ...
(Date:6/17/2013)... have identified a new virus in patients with severe ... determine whether the virus is responsible for the symptoms ... total of 28 out of 644 patients with severe ... but not in any of the 122 patients with ... the brain and central nervous system are often fatal ...
Breaking Biology News(10 mins):Feline behavior experts release guidelines to improve the welfare of cats 2New virus isolated from patients with severe brain infections 2New virus isolated from patients with severe brain infections 3
Other Tags
primitivespecificdamagehavewilsonlocalizedantibacterialgalliumstandlegalflawedfatallysimilarpeersattractattitudes