Tag: "new" at medical news

Survival differences by race most apparent in advanced stages of breast cancer

...survival increase according to stage of disease, a new study finds. Published in the September 15, 2007 issue of CANCER, a peer-reviewed journal of the American Cancer Society, a retrospective analysis of survival data demonstrates that within each stage, African American women had larger tumors and were...

Spot on treatment for acne

...eatments is worth several billion dollars, and any new treatment developed without side effects could pot...uation, the company says it represents an entirely new class of compounds for treating acne. At the doses we are looking at any side effects should be mild...

Patient-centered approach can backfire

...prefer that style and respond very well to it. But new research at the University of Iowa suggests that it doesn't work for everybody. In fact, some patients are significantly less likely to follow doctors' orders and feel satisfied with their care when physicians take the patient-centered approach. Ac...

New treatment boosts muscle function in myasthenia gravis

ST. PAUL, Minn. - A new type of treatment significantly reduces the severi...kness in myasthenia gravis (MG), giving hope for a new class of drugs to treat neurological disorders, according to a study published in the August 14, 200...

Adverse housing conditions contribute to diabetes risk

...at the time initial interviews were conducted. The new study found that over the next three years another...ich this African-American population is developing new onset diabetes is extremely important as well, Dr. Miller notes. At this rate, and combined with th...

RAND finds cases of undiagnosed diabetes drop sharply

...nosed diabetes disappeared over the past 25 years, new disparities have developed based upon education levels. Less educated American males are now less likely to have their diabetes diagnosed than those men with more schooling. If we only target disparities by race and ethnicity, we run the risk of mi...

News briefs from the journal Chest, August 2007

...nd relief in the form of diuretics, according to a new study. Italian researchers treated 15 patients hos... Difference in CT-Measured Emphysema Identified A new study reveals that in men with chronic obstructive pulmonary disease (COPD), at all stages of severi...

Pot bellies linked to early signs of cardiovascular disease

...nic, urban population with a median age of 45. The new substudy focused on a group of 2,744 participants who had noninvasive imaging tests to look for early signs of plaque build-up in the arteries, which signals an increased risk of developing cardiovascular disease later in life. Electron-beam compu...

Study says COPD testing is not measuring up

... chronic obstructive pulmonary disease (COPD), but new research shows that it is not used nearly enough. ...years and older, and determined if patients with a new diagnosis of COPD had received spirometry in the preceeding 720 days. Of the 5,039 eligible patient...

Regulator of lipid metabolism ensures high quality breast milk

...r skin disorders and facilitate the development of new treatments for these diseases. PPAR acts as a genetic switch, sensitizing the body to insulin and lowering levels of circulating glucose. In fact PPAR drugs, including Actos and Avandia, belong to the newest generation of anti-diabetic medications....

Adverse housing conditions contribute to diabetes risk

...at the time initial interviews were conducted. The new study found that over the next three years another 10 percent developed diabetes. "I think that's a huge finding in and of itself," Schootman says. "Think about how many middle-aged African-Americans live in a place like St. Louis, and if our sampl...

Stomach cancer rate set to fall further 25 percent over next decade

...bsequent stomach cancer. The authors tracked all new cases of atrophic gastritis, intestinal metaplasia...ing period. The figures showed that the rate of new cases fell steadily by between 2.4 and 2.9% a year in women and men, respectively. Dysplasia, whic...

1 of 2 pediatric kidney disease research centers in world established

...llege and Childrens Research Institute, expediting new and exciting treatments for thousands of children ...tic, acquired or progressive kidney disease. This new Center of Excellence designation will enhance our ability to implement our translational research pr...

Disability payments may spur drug abuse

...armful and often fatal drug binges, according to a new study in a forthcoming issue of the Journal of Public Economics that links the monthly arrival of disability checks with a sharp rise in drug related hospitalizations and deaths. The findings by researchers at the University of California, Santa Cruz...

Drug for cluster headaches may cause heart problems

...monitoring, he said. Since this drug is relatively new for use in cluster headaches, its possible that some health care providers are not aware of the problems that can come with its use....

Draining away brain's toxic protein to stop Alzheimer's

... the development of Alzheimers disease, likens the new approach to how statins help people with heart disease. Statins lower excess cholesterol in the bloodstream before the cholesterol can glom onto a blood vessel and cause problems with blood flow; in the same way, LRP-IV lowers amyloid-beta and indire...

Hispanic drug use rises in US culture

...eliefs with those of white Americans, according to new research presented today by Oregon State Universit... Hispanics. Acculturation involves the adoption of new cultural information and social skills by an immigrant group, which often replaces traditional cultu...

Investigators uncover intriguing clues to why persistent acid reflux sometimes turns into cancer

...8 patients with GERD and 16 control patients. This new line of research suggests that the continuous acid bath affecting esophageal cells causes them to divide more frequently in order to regenerate the damaged lining. However, each time the cells divide, the telomeres at the end of DNA become shorter. W...

New cause of tamoxifen resistance in breast cancer cells discovered at Lombardi

...e Cancer Center announced today the discovery of a new mechanism of resistance to endocrine or anti-hormo... once again as treatment schedules are changed and new side effects develop. When cell lines changed from being sensitive to endocrine therapy to being ...

New study shows promise in reducing surgical risks associated with surgical bleeding

CHICAGO (August 10, 2007) Surgeons may have a new patient safety tool to stop moderate surgical blee...ternative to bThrombin. We constantly look for new ways to reduce risks in surgery and stopping surgical bleeding safely and effectively is of foremost...

1 2 3 4 5 6 7 8 9 10

(Date:5/21/2013)... battle? Try staying fit in space, where living quarters ... , That,s the challenge a group of Michigan State ... million grant from NASA. Their goal is to keep ... "You could give astronauts the best exercise regimen there ... to it, it isn,t going to help," said project ...
(Date:5/21/2013)... biomass experts , Where? Copenhagen, Denmark: ... 03-07 June 2013 , Why? ... market and policy developments, manufacturing and installation, drawing on ... from its 2013 edition from a record of more ... more than 240 plenary and oral presentations, more than ...
(Date:5/21/2013)... The epigenetic modifications, which alter the way genes ... apparently be detected in the blood of pregnant ... way to foretell depression in the weeks after ... symptoms become debilitating. , The findings of the ... online in the journal Molecular Psychiatry . ...
Breaking Biology News(10 mins):Fueling fitness on the final frontier 221st European Biomass Conference and Exhibition 221st European Biomass Conference and Exhibition 321st European Biomass Conference and Exhibition 4Genetic predictors of postpartum depression uncovered by Hopkins researchers 2Genetic predictors of postpartum depression uncovered by Hopkins researchers 3
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition