The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "online" at medical news

Study, meta-analysis examine factors associated with death from heatstroke

...zation for heatstroke, according to a study posted online today that will appear in a later print issue of A...A meta-analysis of previous studies also published online today found that being confined to bed, not leaving home daily or being unable to care for oneself a...

DNA vaccine against multiple sclerosis appears safe, potentially beneficial

...multiple sclerosis, according to an article posted online today that will appear in the October 2007 print issue of Archives of Neurology, one of the JAMA/Archives journals. In patients with multiple sclerosis (MS), the immune system attacks the myelin sheaths that protect nerve cells in the brain and spi...

Study suggests loss of 2 types of neurons -- not just 1 -- triggers Parkinson's symptoms

...of the National Academy of Sciences, Early Edition online during the week of Aug. 13-17 and in the Aug. 21 print edition. The research was conducted by Karen Rommelfanger, graduate student in the laboratory of David Weinshenker, PhD, assistant professor of human genetics in Emory University School of Med...

Anemia and tropical diseases; Is pharmacogenomics ready for the clinic?

...e links below to take your readers straight to the online articles: FROM THE PLoS MEDICINE MAGAZINE SECTION: Could anemia be used to assess the burden and control of neglected tropical diseases" In this week's PLoS Medicine, a team of researchers argues that measuring anemia could be a good way of ...

Disability payments may spur drug abuse

...er reviewed Journal of Public Economics, though an online version is available now. The study notes that for both groups the increase in hospital admissions begins shortly after the checks arrive. SSI aid arrives on the first of the month and hospital admissions begin rising on the second while DI aid arri...

Draining away brain's toxic protein to stop Alzheimer's

.... Thats the method outlined in a paper published online August 12 by Nature Medicine. Scientists from the University of Rochester Medical Center show how the bodys natural way of ridding the body of the substance is flawed in people with the disease. Then the team demonstrated an experimental method in mi...

Investigators uncover intriguing clues to why persistent acid reflux sometimes turns into cancer

...e data that supports that. In research available online prior to printing this month in Diseases of the Esophagus, Drs. Souza, Spechler and colleagues demonstrate that bone-marrow cells come into play to regenerate the esophageal lining in rats that have heavy reflux. So the first paper shows that the t...

New cause of tamoxifen resistance in breast cancer cells discovered at Lombardi

...to protect cells from damage. In a paper published online in the Journal of the Federation of American Societies for Experimental Biology (FASEBJ) on July 27, Clarke and his colleagues at the Lombardi Comprehensive Cancer Center (part of Georgetown University Medical Center) found that over-expression of ...

Penn study finds pro-death proteins required to regulate healthy immune function

...timulates cell division. The results, published online in the journal Immunity, bolster the teams hypothesis that metabolic cell activity directly controls life and death decisions in cells. This issue also includes a related commentary by the studys lead author, Russell Jones, PhD, and senior author Cra...

Reanalysis of controversial meta-analysis says writing off rosiglitazone may be premature

...abetes, came under fire after an article published online May 21 by the New England Journal of Medicine link...dial Infarction and Cardiovascular Death" appeared online Aug. 7. Both physicians testified Monday, July 30, before a Food and Drug Administration advisory ...

Not all 'drug-related deaths' are 'drug-related'

...and Alcohol Action Teams, a study published in the online open access journal Substance Abuse Treatment, Prevention and Policy suggests. DRDs are currently used to help evaluate the success of Drug and Alcohol Action Teams in England and Wales, but the term's exact meaning varies according to European and...

Long heat waves boost hospital admissions

... hospitals, according to research published in the online open access journal, BMC Public Health. The good news for hospital staff is that scorching weather must last four or more days before admissions rise significantly. Giuseppe Mastrangelo and his team from the University of Padova, Italy, examined ho...

Diets high in choline may increase risk for colorectal polyps

... colorectal cancer, according to a study published online in the August 7 Journal of the National Cancer Institute . Major food sources of choline include red meat, eggs, poultry, and dairy products. Choline is involved in a biochemical process known as one-carbon metabolism. Studies have shown that peop...

Chemotherapy with bevacizumab increases risk of blood clots in arteries

... chemotherapy only, according to a study published online August 7 in the Journal of the National Cancer Institute . The combination of chemotherapy and bevacizumab has been shown to increase survival in patients with metastatic colorectal and nonsmall-cell lung cancer, but some previous studies suggest ...

Novel candidate biomarker for heart failure also strongly predicts risk of death

...ican College of Cardiology that has received early online release, an international research team describes finding that blood levels of a protein called ST2 both indicate the presence of heart failure among patient with shortness of breath and powerfully predict the risk that a patient will die during the ...

Annals of Internal Medicine tip sheet for Aug. 7, 2007, issue

...zone. (This Perspective piece is published early online by Annals of Internal Medicine at www.annals.org. Authors appeared before the FDA advisory panel on cardiovascular ischemic/thrombotic risks of the thiazolidinediones on July 30, 2007.) 2. Geriatric Conditions Are Common but Often Overlooked ...

Researchers link metal ions to neurodegenerative disease

...of the National Academy of Sciences, Early Edition online during the week of Aug. 6-10 and in the Aug. 14 print edition. Copper ions, atoms that have acquired an electric charge by gaining or losing one or more electrons, are found naturally in the brain, as are other ions such as zinc and iron. Increasin...

Decision aid for diabetes

...e links below to take your readers straight to the online articles: FROM THE PLoS MEDICINE MAGAZINE SECTION: Developing a decision aid for patients with diabetes Victor Montori (Mayo Clinic) and colleagues share lessons learned from their development of Statin Choice, a decision aid for patients with diab...

Medical residents score poorly in diagnosing and managing tuberculosis

...Hopkins and elsewhere. In the survey, published online Aug. 2 in the British journal BMC Infectious Diseases, 131 medical residents were asked to answer 20 basic questions about the contagious lung disease, recently made the subject of international concern when a traveler was believed to have its most s...

Medical residents unclear about TB guidelines

...losis (TB), according to a report published in the online open access journal, BMC Infectious Diseases. Dr. Petros Karakousis et al. from the Johns Hopkins University School of Medicine, US, administered a twenty-question survey about TB to 131 medical residents attending a single teaching conference at...

1 2 3 4 5 6 7 8 9 10

(Date:11/19/2008)... worms, sponges, jellyfish - have the simplest eye...ls: a photoreceptor cell and a pigment cell. These...o-eyes, suggested by Charles Darwin as the first e...m images but allow the animal to sense the directi...s the swimming towards light exhibited by many zo...
(Date:11/19/2008)...,s Research Hospital have gained new insights into... called calpains. , As the cell,s molecular ove...cesses, including the movement of cells in tissues...nd brain cell and muscle function. The downside of...ive or overactive calpains have been linked to an ...
(Date:11/19/2008)...lapse of star-forming clouds to the flow of the mo... in your car engine to the coursing blood in your ...entration of microscopic animals in the ocean, man... of fluid flow. , The 61st Annual Meeting of the...amics, which takes place from November 23-25 at th...
(Date:11/19/2008)...he ancient thinker Archimedes shouted "Eureka" in ...t, scientist though the ages have solved many of l...day, the field of fluid dynamics addresses some of... engineering, alternative energy, and medicine. La...the year devoted to the dynamics of fluids convene...
Breaking Biology News(10 mins):Uncovering secrets of life in the ocean 2New insight into the controls on a go-to enzyme 2New insight into the controls on a go-to enzyme 3The physics of star-forming clouds and the urban environment 2The physics of star-forming clouds and the urban environment 3The physics of star-forming clouds and the urban environment 4The physics of star-forming clouds and the urban environment 5The physics of star-forming clouds and the urban environment 6Jupiter's shrinking red spot 2Jupiter's shrinking red spot 3Jupiter's shrinking red spot 4Jupiter's shrinking red spot 5Jupiter's shrinking red spot 6Jupiter's shrinking red spot 7Jupiter's shrinking red spot 8Jupiter's shrinking red spot 9Jupiter's shrinking red spot 10Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 1Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 2Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 3Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 4Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 5Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 6Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 7Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 8Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 9Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 10Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 11Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 12Carlos A Parra Joins Alexza Pharmaceuticals as Vice President Quality 19558 1Carlos A Parra Joins Alexza Pharmaceuticals as Vice President Quality 19558 2Dont Wait for the Election to Plan Your Long Term Healthcare Insurance Leader Advises 19556 1Dont Wait for the Election to Plan Your Long Term Healthcare Insurance Leader Advises 19556 2QLT Inc announces agreement for sale of real estate 19553 1QLT Inc announces agreement for sale of real estate 19553 2QLT Inc announces agreement for sale of real estate 19553 3
Other Tagsalleviate 2alleviate 3alleviate 4alters 2alters 3alters 4alters 5alters 6alters 7orchestrates 2survived 2survived 3survived 4survived 5survived 6survived 7survived 8survived 9survived 10worsens 2smoke 2smoke 3smoke 4smoke 5smoke 6smoke 7smoke 8smoke 9smoke 10cigarette 2cigarette 3cigarette 4cigarette 5cigarette 6cigarette 7cigarette 8cigarette 9cigarette 10month 2month 3month 4month 5month 6month 7month 8month 9month 10rewarding 2
alleviatealtersorchestratesjudesnowballsurvivedsmearspapworsenssmokecigarettemonthyipsspellsrewardingmagnifies