The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "portable" at medical news

Nanotechnology's miniature answers to developing world's biggest problems

...n." Nano-membranes and nano-clays are inexpensive, portable and easily cleaned systems that purify, detoxify and desalinate water more efficiently than conventional bacterial and viral filters. Researchers also have developed a method of large-scale production of carbon nano-tube filters for water quality imp...

Breast cancer detector that uses electricity instead of X-rays under study

A painless, portable device that uses electrical current rather than X-ray to examine breasts for cancer is under study at the Medical College of Georgia. MCG is one of some 20 centers across the world studying impedance scanning, a technique based on evidence that elect...

New portable device developed by Georgia Tech and Emory checks for concussions on the sidelines

...ated system that includes software applications, a portable computer and an LCD display in the headgear. While a typical mTBI test requires a quiet room and 1-2 hours of testing, DETECT performs neuropsychological tests in an immersive environment in about 7 minutes, regardless of surrounding noise and movem...

Guava and AHF Global Immunity bring low cost AIDS diagnosis to resource-limited countries

... anti-retroviral drugs, accurate but simpler, more portable and less costly methods of CD4+ testing are urgent...ology enables the instrument to be highly compact, portable and low maintenance. Performance of the Guava assays is quite simple, with even novice users learnin...

Ultrasound images transmitted over the phone allow radiologists to diagnose patients in real time

... purposes or better than adequate," he added. "The portable ultrasound machine we used to create the images in Yugoslavia is a relatively simple machine and, in some of the cases, the resolution problems could have been more of a problem with the original images than the compressed images." "Our objective is...

Don't skip chest CT in the ER just because x-ray checks out okay, warns study

...chers, multiple trauma patients also first receive portable chest X-rays upon entry into the emergency department. "A doctor would get the chest X-ray done, and then order a CT, but tell the radiologist to omit the chest part of the CT because the X-ray was already performed and showed no problems for the pat...

Fluorescence device to diagnose atherosclerosis and tumors described at optics conference

...le the components are now small enough to fit on a portable cart that can be taken into an operating room, additional studies on miniaturization of components and instruments are planned. In fact, the National Institutes of Health is providing funding for the development of microdevices. While the basic hardw...

Low heart rate variability in depressed patients contributes to high mortality after heart attack

..." To monitor heart rate variability, patients wore portable heart monitors for 24 hours after their heart attack. Heart rate variability measures how the heart adjusts to varying levels of demand. In people with low heart rate variability, the heart doesn't make adjustments as quickly as needed. "We have know...

OHSU researchers help develop portable device to assist those combating balance disorders

...ute and the University of Bologna have developed a portable "Ipod-like" device that can be used to help correct balance disorders. Scientists believe this new device, based on auditory feedback of balance, can be worn on the belt like a pager to provide regular therapy for patients with balance disorders, imp...

A friendly reminder for HIV patients

...hat the device, dubbed "Jerry" by most users, is a portable gadget programmed to ease the task of taking medicines in multiple doses every day on time. HIV-infected patients, particularly those suffering from mild memory loss from the disease, benefit highly from Jerry's friendly reminders, according to a st...

Detecting Alzheimer's in the eye, lifting fingerprints without touching the surface

...hnology, theresearchers believe that a handheld or portable system, using onelaser for both fragmentation and ionization, can be made for between$25,000 and $50,000. (Paper FThX6, Real-Time Detection of ExplosiveResidues by Surface Laser Photofragmentation-Fragment IonizationSpectroscopy, Thursday, October 20...

Clinical decision system helps reduce inappropriate antimicrobial prescribing

...e feasibility, uptake, and benefit of stand-alone, portable CDSS tools for acute respiratory infections in rural primary care settings. The CDSS decreased unnecessary use of antimicrobial agents for viral respiratory tract infections and improved antimicrobial agent selection," the authors write. "An unresolv...

Air in Fallon, Nev. has elevated levels of tungsten and cobalt

...e spring and fall of 2004. The researchers placed portable air samplers at various sites in the towns. The samplers took in a known volume of air. Dust from the air was captured on filters and analyzed at the University of Missouri-Columbia for 19 different metals using a technique called acid-dissolution, i...

A pocketful of help for Alzheimer's sufferers and caregivers

... Care." The researchers will develop a portable caregiver support system called PocketBuddy. The system would issue audio and text reminders to the caregiver, which could include medication information, appointment reminders and automated checklists for daily support. Also embedded could be such i...

New brain scan technology could save babies' lives

A revolutionary portable brain scanner under development could aid the treatment, and in some cases help save the lives, of premature and newborn babies in intensive care. By providing vital information about brain function at the cot side, the scanner avoids the need to mov...

Researchers develop portable 'vein finder' for faster, more accurate injections

...finder is the system's design, which makes it both portable and economical," says Peter Rogers, a professor in Georgia Tech's School of Mechanical Engineering. The patent-pending vein finder is composed of two parts: A reusable unit houses the electronics and signal processing components, while a disposable ...

Procedure for irregular heartbeat gives long-lasting relief & improves quality of life

...pted for ablation. For a year, all patients used a portable monitor to record their heart rhythm several times a day and any time their heartbeat became irregular. Those recordings were transmitted by phone to a central location and the rhythm patterns were analyzed by cardiologists who did not know which pat...

Should heart attack care be more like trauma care? Study suggests regional system could be feasible

...uish STEMI heart attacks from other problems using portable electrocardiogram equipment, since only STEMI patients have been shown to derive more benefit from emergency angioplasty than from fibrinolytic (clot-busting) drugs that can be given at most hospitals. Research by the new paper's authors and others ...

Going the extra mile for specialized heart attack care

...uish STEMI heart attacks from other problems using portable electrocardiogram equipment, since only STEMI patients have been shown to benefit most from emergency angioplasty than from fibrinolytic (clot-busting) drugs that are provided at most hospitals. The authors say this research is a first step that does...

Purdue chemical-analysis method promises fast results

...SI, Cooks' research group has designed and built a portable instrument that is roughly the size of a shoebox and weighs about 10 kilograms (22 pounds), compared to about 30 times that weight for a conventional mass spectrometer. The lightweight instrument can run on batteries, which means it can be carried an...

1 2 3

(Date:11/19/2008)... worms, sponges, jellyfish - have the simplest eye...ls: a photoreceptor cell and a pigment cell. These...o-eyes, suggested by Charles Darwin as the first e...m images but allow the animal to sense the directi...s the swimming towards light exhibited by many zo...
(Date:11/19/2008)...,s Research Hospital have gained new insights into... called calpains. , As the cell,s molecular ove...cesses, including the movement of cells in tissues...nd brain cell and muscle function. The downside of...ive or overactive calpains have been linked to an ...
(Date:11/19/2008)...lapse of star-forming clouds to the flow of the mo... in your car engine to the coursing blood in your ...entration of microscopic animals in the ocean, man... of fluid flow. , The 61st Annual Meeting of the...amics, which takes place from November 23-25 at th...
(Date:11/19/2008)...he ancient thinker Archimedes shouted "Eureka" in ...t, scientist though the ages have solved many of l...day, the field of fluid dynamics addresses some of... engineering, alternative energy, and medicine. La...the year devoted to the dynamics of fluids convene...
Breaking Biology News(10 mins):Uncovering secrets of life in the ocean 2New insight into the controls on a go-to enzyme 2New insight into the controls on a go-to enzyme 3The physics of star-forming clouds and the urban environment 2The physics of star-forming clouds and the urban environment 3The physics of star-forming clouds and the urban environment 4The physics of star-forming clouds and the urban environment 5The physics of star-forming clouds and the urban environment 6Jupiter's shrinking red spot 2Jupiter's shrinking red spot 3Jupiter's shrinking red spot 4Jupiter's shrinking red spot 5Jupiter's shrinking red spot 6Jupiter's shrinking red spot 7Jupiter's shrinking red spot 8Jupiter's shrinking red spot 9Jupiter's shrinking red spot 10Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 1Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 2Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 3Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 4Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 5Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 6Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 7Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 8Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 9Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 10Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 11Genesis Pharmaceuticals Reports Results for the Third Quarter of Fiscal Year 2008 19560 12Carlos A Parra Joins Alexza Pharmaceuticals as Vice President Quality 19558 1Carlos A Parra Joins Alexza Pharmaceuticals as Vice President Quality 19558 2Dont Wait for the Election to Plan Your Long Term Healthcare Insurance Leader Advises 19556 1Dont Wait for the Election to Plan Your Long Term Healthcare Insurance Leader Advises 19556 2QLT Inc announces agreement for sale of real estate 19553 1QLT Inc announces agreement for sale of real estate 19553 2QLT Inc announces agreement for sale of real estate 19553 3
Other Tagsalleviate 2alleviate 3alleviate 4alters 2alters 3alters 4alters 5alters 6alters 7orchestrates 2survived 2survived 3survived 4survived 5survived 6survived 7survived 8survived 9survived 10worsens 2smoke 2smoke 3smoke 4smoke 5smoke 6smoke 7smoke 8smoke 9smoke 10cigarette 2cigarette 3cigarette 4cigarette 5cigarette 6cigarette 7cigarette 8cigarette 9cigarette 10month 2month 3month 4month 5month 6month 7month 8month 9month 10rewarding 2
alleviatealtersorchestratesjudesnowballsurvivedsmearspapworsenssmokecigarettemonthyipsspellsrewardingmagnifies