Tag: "when" at medical news

Using coxibs and NSAIDs to treat osteoarthritis

...urge that an evidence-based approach must be taken when making recommendations to patients. OA, the most common form of arthritis, is a major medical problem. It has been estimated that over 20 million Americans are afflicted with OA, and that number will rise to 40 million by the year 2020. Controversy...

Patient-centered approach can backfire

...doctors' orders and feel satisfied with their care when physicians take the patient-centered approach. A...laining a condition and seeks little patient input when it comes to treatment decisions. The study showed that when those patients are matched with patient-...

New treatment boosts muscle function in myasthenia gravis

... able to show that antisense is effective and safe when taken orally for a neurological disease, said study author Zohar Argov, MD, with Hadassah Hebrew University Medical Center in Jerusalem and member of the American Academy of Neurology. Oral delivery of antisense has long been sought after since it i...

Study, meta-analysis examine factors associated with death from heatstroke

...raphic, medical and functional data were collected when individuals entered the hospital, and they were assessed again after 28 days and one and two years. Fifty-eight percent of patients died within 28 days. Patients who died: more often came from an institution for the elderly (24 of 48 non-survivo...

RAND finds cases of undiagnosed diabetes drop sharply

... they had the disease, in contrast to 25 years ago when about half of the men with diabetes were undiagnos...ore than doubling of the prevalence rate. However, when undiagnosed cases were considered as well, diabetes prevalence rose overall from 6 percent to 9 perc...

Comparison of obstetric outcomes between on-call and patients' own obstetricians

...11.4% v. 11.9%) in the rate of cesarean deliveries when women are cared for by an on-call obstetrician rather than their regular-care obstetrician. In a related commentary, Dr. Chaim M. Bell PhD and Dr. Joel G. Ray MSc, highlight the importance of ensuring smooth hand-offs of patient care between physi...

News briefs from the journal Chest, August 2007

...at there was no difference in mortality or safety, when compared with first-line antibiotics. This study appears in the August issue of CHEST, the peer-reviewed journal of the American College of Chest Physicians. Gender Difference in CT-Measured Emphysema Identified A new study reveals that in men wi...

Pot bellies linked to early signs of cardiovascular disease

Most of us rely on the bathroom scale to tell us when middle-aged spread is getting out of hand. It migh...ing. Even a small pot belly puts us at higher risk when compared to a flat tummy. For the study, Dr. de Lemos and his colleagues examined data from the on...

Study says COPD testing is not measuring up

...ews is that women and men fared virtually the same when it came to spirometry testing, despite previous reports suggesting women were tested less often. COPD is currently the fourth leading cause of death in the United States, and the economic burden of this disease is measured in the billions of dollar...

Study suggests loss of 2 types of neurons -- not just 1 -- triggers Parkinson's symptoms

...rcent of their dopamine neurons are gone, which is when you cross some sort of threshold. Our study looked...ed no motor impairments in the mice. Surprisingly, when they tested mice unable to synthesize norepinephrine and that have trouble releasing dopamine proper...

Regulator of lipid metabolism ensures high quality breast milk

...hy breast milk is always clean and healthful, even when theres a lot of inflammation going on in the mothers body, he adds. The Salk research team led by Evans published their findings in the August issue of the journal Genes & Development. They hope that a better understanding of PPAR could help expla...

Grandparents, older adults encouraged to seek help for a sleep disorder

...nd engage in a quiet activity. Return to bed only when you are tired. Keep your bedroom dark, quiet and a little cool. Dr. Krainson says that, although sleep patterns change as people age, disturbed sleep and waking up tired every day are not part of normal aging. Those who have trouble ...

Adverse housing conditions contribute to diabetes risk

...se, alcohol use, marital status and education. But when the researchers adjusted for all of those factors, housing conditions still influenced diabetes risk. "So far we can't explain why that is," Schootman says. "It could potentially be related to lead. Lead is associated with the development of diabet...

1 of 2 pediatric kidney disease research centers in world established

...d diabetes-induced disease; and occurring injuries when the kidney lacks oxygen. According to the new Centers associate director, Richard Roman, Ph.D., professor of physiology and pediatrics, and director of the Kidney Disease Center at the Medical College, Our research will provide physicians with new w...

Drug for cluster headaches may cause heart problems

...months generally followed by a period of remission when the headaches stop. The benefit of taking verapamil to alleviate the devastating pain of cluster headaches has to be balanced against the risk of causing a heart abnormality that could progress into a more serious problem, said study author Peter ...

MRI finds breast cancer before it becomes dangerous

...s be treated successfully by operating on it. Only when the tumour grows out of the milk ducts into the breasts glandular tissue can it spread via blood and lymph vessels in the body. 'If we find DCIS and remove it we can prevent the formation of real breast cancer,' the Bonn radiologist Professor Christi...

Investigators uncover intriguing clues to why persistent acid reflux sometimes turns into cancer

...testinal and Liver Physiology . Heartburn occurs when acid splashes back up from the stomach into the es... divide, Dr. Souza said. Scientists suspect that when cells can no longer divide, other cells might infiltrate the area to make up for the loss. And those...

New cause of tamoxifen resistance in breast cancer cells discovered at Lombardi

...ean that the effects of XBP1 over-expression occur when the protein is bound to the estrogen receptor, suggesting for the first time that these two proteins interact in the cell. This was the first evidence that the XBP1 protein may play a role in breast cancer pathways. Through molecular profiling of ...

Test project of patient-centered medical home model endorsed by American College of Physicians

... This is what physicians-in-training signed up for when they elected to become internists and this is the care that patients want and deserve, Kay Mitchell, MD, FACP, the other ACP Florida chapter governor, said. The PCMH has great promise for overcoming many of the challenges including quality, patient ...

Penn study finds pro-death proteins required to regulate healthy immune function

...lar membranes. Specifically, the team found that when the T-cell receptor was stimulated on mutant cells lacking both proteins, proliferation was severely reduced relative to normal cells. Closer investigation showed that the amount and rate of calcium release from intracellular stores was altered in th...

1 2 3 4 5 6 7 8 9 10

(Date:6/17/2013)... CORVALLIS, Ore. Amphibian populations are declining worldwide and ... be spread by bullfrogs, but a two-year study shows ... suggestions that bullfrogs are a tolerant carrier host that ... frogs from eggs in controlled experimental conditions, they found ... dendrobatidis , also called Bd or a chytrid fungus, ...
(Date:6/16/2013)... prevention programs for female sex workers in India reduce ... (STIs), a University of Toronto study has found. ... HIV, mostly in the southern states of Andhra Pradesh, ... Professor Prabhat Jha from U of T,s Dalla Lana ... for Global Health Research (CGHR), examined the impact of ...
(Date:6/16/2013)... ago triggered a similar marine ecosystem crisis to those ... warming, according to research published today in Nature ... universities of Newcastle, UK, Cologne, Frankfurt and GEOMAR-Kiel, confirms ... the marine ecosystem during the mid-Cretaceous greenhouse period. ... amplitude and duration of the temperature change.,Analysing the geochemistry ...
Breaking Biology News(10 mins):Bullfrogs may help spread deadly amphibian fungus, but also die from it 2HIV prevention among female sex workers in India reduces HIV and syphilis 2Global cooling as significant as global warming 2
Other Tags
comparablemarimastatketektenthdarklyairwayeditsfluorideappropriationsconveysasmusualunprovengambiaopposeshivma