Tag: "abnormality" at medical news

Increasing benefit seen in novel drug that treats Gleevec resistance

...aterial in bone marrow stem cells that produces an abnormality called the Philadelphia chromosome. This chromosome contains a new fused-together gene, BCR-ABL, which produces an enzyme that switches on uncontrolled growth in the bone marrow cell. Gleevec binds to this Bcr-Abl enzyme, shutting down its activity, ...

Revised Bethesda guidelines effective at identifying patients at risk of colorectal cancer

... and MLH1. In HNPCC, colorectal tumors have a DNA abnormality called microsatellite instability. Although a great advance in the understanding of the molecular basis of HNPCC has taken place in the last decade, optimal selection of individuals for HNPCC genetic testing remains challenging. Virginia Pinol, M....

Access to mammography may worsen

...rmed to resolve a question related to a symptom or abnormality of the breast) within one week of a request, while only 30 percent of facilities had the ability to schedule screening mammograms (performed on asymptomatic women to detect early signs of cancer) within a week. Nearly half (47 percent) reported a wai...

'Surprising' findings reported about iron overload

...nt of iron from food and supplements ingested. The abnormality affects many people worldwide, is prevalent in the South, and sometimes causes organ damage when severe iron deposition occurs due to inadequate control of iron absorption by the small intestine. The first major report of findings in the five-year,...

Heart scan surprises: CT reveals many non-heart problems, too

...o read all the scans, found some sort of non-heart abnormality in 61 percent of the patients. Many of these were judged insignificant. But in the 43 patients who had significant or potentially significant findings, the range of severity was wide. In 16 patients, lung nodules larger than 4 millimeters in diamete...

Lorenzo's oil shows promise in reducing risk of debilitating disease in genetic disorder

...fatty acid C26:0. "Patients who had a neurological abnormality had significantly higher weighted average C26:0 levels than those who did not have an abnormality, suggesting that an LO-induced decrease in the C26:0 level could protect against the inflammatory cerebral disease," the authors report. "We recommend t...

Study shows new imaging tracer clarifies cause of chest pain up to 30 hours after pain stops

...parison showed the two tracers pointed to the same abnormality in the heart in over 90 percent of the cases. This suggests that disturbances in fatty acid metabolism can persist up to 30 hours after an ischemic episode, which can be imaged with the new tracer Zemiva. Additional testing will be required before ...

Consensus panel calls for expanded role of needle biopsies, MRI and less invasive procedures

...mprehensive Cancer Center. "If a surgeon knows the abnormality is breast cancer before an operation, he or she can more precisely plan the optimal location of the incisions in the breast for breast conservation. With pre-operative planning, more complete and precise removal of the cancer is more likely, generall...

EBCT scans trump angiography at detecting killer heart defect

...ography for detecting a dangerous congenital heart abnormality that could cause sudden death, according to resear...f of the patients, angiography showed a congenital abnormality for example, a left coronary artery originating from the right side of the aorta, or vice versa. EB...

Shortness of breath without chest pain can signify the presence of high risk heart disease

...ed risk, most did not. Yet in the patients without abnormality of pumping function, there was a tripling of cardiac events rates in those who had shortness of breath. One possibility is that shortness of breath in the patients sent for testing is related to ischemia--to little blood flow to the heart muscle. Ho...

Mayo Clinic: Sinusitis is common yet often overlooked cause of chronic cough

...e same patient," he says. "That's why even when an abnormality has been diagnosed, it has to be treated specifically. Only once this abnormality has resolved and in parallel the cough resolves, can you say whether or not the condition diagnosed ...

Synaptic connections need nurturing to retain their structure and keep outsiders at bay

...t these unoccupied spines led to a second synaptic abnormality in the cbln1-/- model: the pattern of synapses between the Purkinje cells and another type of nerve, called the climbing fibers, was abnormal. Normally, only one climbing fiber makes a synapse with a particular Purkinje cell. But in the cbln1-/- mode...

Bluhm Cardiovascular Institute surgeons implant heart pump in comparative study of two devices

...nts at other hospitals and an existing bone marrow abnormality ruled out a heart transplant. A friend recommended he come to the Bluhm Cardiovascular Institute at Northwestern Memorial Hospital where he learned about a first-of-its-kind, national, multi-center clinical trial that compares heart pumps from two di...

New technology may help radiologists find more breast cancers

...tic imaging technique for follow-up of a potential abnormality in the breast, tomosynthesis was as good if not better than diagnostic mammography in 88 percent of patients. Dr. Poplack is optimistic about the ability of tomosynthesis to improve the overall accuracy of diagnosing breast disease. "Tomosynthesis is...

Insulin levels drop with progression of Alzheimer's disease, linked to tangles in brain

... dementia and has long been recognized as an early abnormality in Alzheimer's. They found that insulin and IGF-I stimulate the expression of choline acetyltransferase (ChAT), the enzyme responsible for making acetylcholine. This discovery shows a direct link between insulin and IGF-I deficiency and dementia. "W...

AMN107 has potent activity in leukemia resistant to Gleevec

...ocytic leukemia (ALL) that shares the same genetic abnormality as CML, the Philadelphia chromosome. "This drug is...m cells between two chromosomes, which produces an abnormality called the Philadelphia chromosome. This new gene then produces a novel tyrosine kinase (Bcr-Abl) th...

New studies identify advances in treatment of chronic myeloid leukemia

...sually diagnosed by finding a specific chromosomal abnormality called the Philadelphia chromosome (Ph chromosome)...the result of translocation a genetic chromosomal abnormality between the long arms of chromosomes 9 and 22. The result is that part of the BCR (breakpoint clus...

St. Jude projects 90 percent cure rate for ALL

..., the authors reported. For example, a chromosomal abnormality called the TEL-AML1 fusion gene, which is an abnor...patients whose leukemic cells have another genetic abnormality called the Philadelphia chromosome or a very low number of chromosomes--hypodiploidy--are at increas...

Brain abnormality found in Alzheimer's disease related to gait impairment in older persons

...entia. Neurofibrillary tangles are a classic brain abnormality seen in Alzheimer's disease. The more tangle pathology in the substantia nigra, the more impaired the person's gait was before death. "Older persons without Parkinson's disease often exhibit parkinsonian signs, such as difficulty with walking and bal...

Study finds nerve damage in previously mysterious chronic pain syndrome

... (MGH) have found the first evidence of a physical abnormality underlying the chronic pain condition called reflex sympathetic dystrophy or complex regional pain syndrome-I (CRPS-I). In the February issue of the journal Pain, they describe finding that skin affected by CRPS-I pain appears to have lost some smal...

1 2 3

(Date:5/20/2013)... New research suggests that a compound abundant in the ... death. , By altering a very specific step ... into normal cells that die as scheduled. , One ... process that would cause them to die on a ... study in cells, led by Ohio State University researchers, ...
(Date:5/20/2013)... - A novel vaccine study from South ... that will be unveiled at the American Association of ... takes place Monday, May 20 - Wednesday, May 22 ... , "The main goal of a vaccine is to ... that causes the disease", explained Dr. Hemachand Tummala, assistant ...
(Date:5/20/2013)... USA New Geology articles posted ... 2013 cover a wide swath of geoscience subdisciplines, ... geophysics, and paleobotany. Locations studied include Siberia; the ... Alpi Apuane, Italy; Ukraine; Mars; and the Southeastern ... 1. Rubies, jadeite, and plate tectonics;, 2. The ...
Breaking Biology News(10 mins):The compound in the Mediterranean diet that makes cancer cells 'mortal' 2The compound in the Mediterranean diet that makes cancer cells 'mortal' 3Germ-fighting vaccine system makes great strides in delivery 2New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 2New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 3New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 4New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 5New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 6New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 7New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 8New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 9New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 10New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 11
Other Tags
confidentialitydisorderspsychiatricfindingtakecampaignsmediaasmsubarachnoidfetusesantherosclerosisathleticismzincinsertssalediscourages